1 UNIVERSIDADE ESTADUAL PAULISTA FACULDADE DE MEDICINA VETERINÁRIA E ZOOTECNIA DEPARTAMENTO DE CLÍNICA VETERINÁRIA FREQUÊNCIA ALÉLICA DA VARIANTE DMRT3 g.22999655C>A (EquCab2.0) EM ASININOS E MUARES COM MARCHA BATIDA E PICADA MARIANA HERMAN Botucatu-SP 2 2023 UNIVERSIDADE ESTADUAL PAULISTA FACULDADE DE MEDICINA VETERINÁRIA E ZOOTECNIA DEPARTAMENTO DE CLÍNICA VETERINÁRIA FREQUÊNCIA ALÉLICA DA VARIANTE DMRT3 g.22999655C>A (EquCab2.0) EM ASININOS E MUARES COM MARCHA BATIDA E PICADA MARIANA HERMAN Tese apresentada junto ao Programa de Pós-Graduação em Medicina Veterinária para obtenção do título de Doutor. Orientador: Professor Assistente Doutor José Paes de Oliveira Filho (FMVZ/UNESP). Co-Orientador: Professor Adjunto Alexandre Secorun Borges (FMVZ/UNESP). 3 4 MARIANA HERMAN FREQUÊNCIA ALÉLICA DA VARIANTE DMRT3 g.22999655C>A (EquCab2.0) EM ASININOS E MUARES COM MARCHA BATIDA E PICADA COMISSÃO EXAMINADORA Professor Dr. José Paes de Oliveira Filho Presidente e Orientador Departamento de Clínica Veterinária – FMVZ/UNESP – Botucatu-SP. Professor Dr. Cesar Erineudo Tavares de Araújo Membro Centro Universitário Dr. Leão Sampaio – Unileão – Juazeiro do Norte-CE Professor Dr. Alexandre Secorun Borges Membro Departamento de Clínica Veterinária – FMVZ/UNESP – Botucatu-SP. Professor Dr. Camila Dantas Malossi Membro Instituto de Biotecnologia – IBTEC/UNESP – Botucatu-SP. Professor Dr. Campo Amor Vieira da Cunha Neto Membro Departamento de Medicina Veterinária - UFJF – Juiz de Fora-MG. Data da Defesa: 11 de agosto de 2023. 5 À minha filha Rafaella e à todos aqueles que fizeram parte da minha jornada até a docência. 6 AGRADECIMENTOS Agradeço primeiramente à energia sincrônica do universo que me permitiu iniciar e finalizar essa jornada, colocando em meu caminho as ferramentas e principalmente as pessoas que foram de suma importância para essa realização. À minha filha Rafaella Herman Rolim, com você descobri o real significado da palavra motivação. Tudo sempre será por você e para você. Obrigada por estar ao meu lado, me compreender e me aceitar. Obrigada por me ensinar sobre o amor. Acima de tudo, obrigada por dividir a sua mãe com a profissão, não ter tido que escolher foi um enorme privilégio, afinal, ambas sabemos que eu escolheria você um milhão de vezes. Ao meu orientador, Prof. Dr. José Paes de Oliveira-Filho, pelo exemplo. Por toda compreensão e amparo em meio às tormentas da vida acadêmica, profissionais e pessoais. Levo desse relacionamento muito mais que um título de mestre ou doutora, algo que vai além do conhecimento técnico. Uma grande parte da professora e orientadora que me tornei, devo ao senhor e à sua paciência. Agradeço à minha família, meus colegas de pós graduação, meus amigos e meus alunos pelos momentos vividos, pelas risadas, pelas trocas e pelo incentivo para persistir sempre. Aos animais e à minha profissão, que junto com a minha filha, me trouxeram propósito para existir. Ser mãe, professora e ser médica veterinária me construíram como sou e sem isso uma enorme parte de mim se perderia. Finalmente agradeço à FMVZ, Unesp de Botucatu e todas as pessoas que ali trabalham pelo acolhimento e aprendizado e à instituição FAPESP de fomento à pesquisa. O presente trabalho foi realizado com apoio da Coordenação de Aperfeiçoamento de Pessoal de Nível Superior - Brasil (CAPES) - Código de Financiamento 001. 7 Lista de Siglas e Abreviações Ct - Ciclo Threshold DMRT3 - Doublesex and mab-3 related transcription factor 3 DNA - Ácido Desoxirribonucleico mRNA - RNA mensageiro PB - Pares de base PCR- Reação em Cadeia da Polimerase PCR - RFLP - Reação com enzima de restrição RNA - Ácido Ribonucleico SNP - Single nucleotide polymorphism 8 Lista de Figuras Figura 1. Imagem representando asinino sendo usado para transporte de carga no interior do estado da Bahia. Tirada em julho de 2016...................................................................................................................06 Figura 2. Imagem representando uma égua com um muar ao pé.......................................................................................................................06 Figura 3. Imagem de Jumento macho (asinino) utilizado comercialmente na produção de híbridos marchadores...................................................................07 Figura 4. Imagem de Jumenta fêmea com jumento ao pé................................07 Figura 5. Jumento apresentado bípedes laterais na passada.............................................................................................................10 Figura 6. Jumenta apresentando movimento bipedal diagonalizado (A) seguido de tríplice apoio (B) evidenciado pela seta vermelha no membro em suspensão..........................................................................................................10 Figura 7. Sequência codificante do gene DMRT3 obtida do Equus caballus isolate Twilight breed thoroughbred chromosome 23, EquCab3.0 (GenBankTM NC_009166.3:2237839922378896)...................................................................19 Figura 8. Gel de agarose a 2% mostrando a corrida eletroforética de RFLP para genotipagem da variante DMRT3_chr23:g.22999655C>A.......................21 Figura 9. Cromatogramas parciais mostrando os resultados do sequenciamento capilar de homozigoto wild type (A), heterozigoto (B) e homozigoto mutado (C) da variante DMRT3_chr23:g.22999655C>A..............22 9 Lista de Tabelas Tabela 1. Primers usados na amplificação da sequência codificante do gene DMRT3 em jumentos (Equus asinus) e para detecção da variante DMRT3_chr23:g.22999655C>A.........................................................................18 Tabela 2. Distribuição dos genótipos (C/C, C/A e A/A) da variante DMRT3_chr23:g.22999655C>A de acordo com o fenótipo (marchas batida ou picada) em 159 muares.....................................................................................23 Tabela 3. Distribuição dos genótipos (C/C, C/A e A/A) da variante DMRT3_chr23:g.22999655C>A de acordo com o fenótipo (marchas batida ou picada) em 203 jumentos...................................................................................24 10 SUMÁRIO CAPÍTULO 1 RESUMO................................................................................................... 01 ABSTRACT............................................................................................... 02 1 INTRODUÇÃO E JUSTIFICATIVA....................................................... 03 2 REVISÃO DE LITERATURA................................................................. 05 3 OBJETIVO............................................................................................... 14 4 MATERIAL E MÉTODOS........................................................................ 15 5 RESULTADOS E DISCUSSÃO............................................................... 18 6 BIBLIOGRAFIA........................................................................................ 27 CAPÍTULO 2 - Trabalho Científico Trabalho a ser publicado na revista “Frontiers in Veterinary Science” 32 11 1 HERMAN, M. Frequência alélica da variante responsável pela marcha (dmrt3, 22999655c>a) em asininos e muares. Botucatu, 2016. 33p. Tese (Doutorado) - Faculdade de Medicina Veterinária e Zootecnia, Campus de Botucatu, Universidade Estadual Paulista. RESUMO A variação do gene DMRT3_chr23:g.22999655C>A está correlacionada com tipo de marcha nos equinos, o alelo selvagem-C e o mutante-A foram associados com a marcha batida e picada respectivamente. Jumentos e muares também apresentam marcha batida e picada, e esse estudo objetivou a determinação da frequência do alelo DMRT3 SNP em jumentos e muares marchadores, além de determinar se o genótipo influenciaria diretamente o andamento nesses animais. Para tanto, foram genotipados 159 muares e 203 jumentos. Dentro da amostragem de muares 47% tinham genótipo CC e 53% CA. Já o genótipo CC foi predominante nos jumentos (97%). O genótipo AA não foi encontrado nos muares nem nos jumentos. Ambos os genótipos estavam distribuídos de maneira similar nos muares com o andamento marchado batido ou picado. Já o genótipo CC estava presente na maioria da amostragem independente do andamento, fosse ele picado ou batido, entre os asininos. Já o genótipo CA em asininos mostrou-se mais frequente em jumentos de andamento picado do que naqueles de marcha batida. Os relatos existentes desses três genótipos nas raças Mangalarga e Campolina, as duas principais raças usadas na produção de muares no Brasil, explicam a maior incidência do genótipo CA nos muares e a baixíssima incidência do alelo mutado nos asininos. Nos permitindo especular que o alelo mutado frequente nos muares foi herdado das éguas usadas nos cruzamentos com os jumentos. Finalmente, esses resultados sugerem que a marcha em questão não é influenciada pela mencionada variante e que demais genes e polimorfismos podem justificar essa características em equídeos. Palavras-chave: Equídeos, Brasil, marcha, genotipagem, PCR-RFLP. 2 HERMAN, M. Allele frequency of DMRT3 mutation responsible for gait pattern in mules and donkeys. Botucatu, 2019. 33p. Tese (Doutorado) - Faculdade de Medicina Veterinária e Zootecnia, Campus de Botucatu, Universidade Estadual Paulista. ABSTRACT The DMRT3:g.22999655C>A SNP influences the gait types of horses, and the wild-C and mutant-A alleles have been associated with batida and picada gaits, respectively. Donkeys and mules also have batida or picada gaits, and this study aimed to determine the allele frequency of the DMRT3 SNP in gaited donkeys and mules and to verify whether the genotype influences the type of gait in these animals. Thus, 159-mules and 203-donkeys were genotyped. Among the 159 mules assessed, 47% had a CC genotype, and 53% had a CA genotype. The CC genotype was predominant in the donkeys (97%). The AA genotype was not found in the mules or donkeys. The CC and CA genotypes were similarly distributed in the mule group with batida or picada gaits. The frequencies of the CC genotype in the donkeys were similar, regardless of whether the gait was batida or picada. However, the CA genotype was more frequent in donkeys with a picada gait than in those with a batida gait. The previous description of the three genotypes in Mangalarga and Campolina horses, which are the main breeds involved in the production of marching mules in Brazil, explains the higher percentage of CA mules and the very low presence of the mutated allele in donkeys, allowing us to speculate that the mutated allele was inherited from the mares used in the crosses with donkeys. In addition, these results suggest that the gait is not influenced by the aforementioned mutation and that other genes and polymorphisms may influence the trait in equids. Keywords: Equids, gait, genotyping, PCR-RFLP, Brazil. 3 1. Introdução e Justificativa A equideocultura, caracterizada pela produção de equinos, asininos e muares, está inserida dentro do setor agropecuário que em 2014 representava 23% do Produto Interno Bruto do País (CEPEA, 2014). Segundo o Instituto Brasileiro de Geografia e Estatística (IBGE), em 2012, o número do efetivo de Asininos e Muares no Brasil era de 902.716 e 1.221.756 cabeças respectivamente, no mesmo ano em que o efetivo de equinos era de 5.363.185 cabeças, representando uma parcela de aproximadamente 28% do número de equídeos no território nacional. Mercado esse que o Ministério da Agricultura Pecuária e Abastecimento (MAPA) no ano de 2016 apontou como fonte de 3.500.000 empregos diretos e indiretos em mais de trinta segmentos. Dentre os diversos setores que abastecem esse seguimento estão a criação e a participação em eventos (MAPA, 2016). No Brasil é cultural a criação de equídeos marchadores e a realização de provas de andamento (provas de marcha). Sabe-se ainda que o Brasil é o berço de origem de algumas raças de equinos marchadores, como o Mangalarga Marchador que é originário do sul de Minas Gerais (COSTA, 2005). O Jumento Pêga e o Jumento Brasileiro também são raças nacionais de asininos e muares marchadores (TORRES, 1992). Entende-se que a utilização destes na produção dos muares e a expansão na criação, em especial da raça Pêga, está associada ao seu potencial genético pelo andamento marchado que agrega valor econômico ao equídeo (MOREIRA, 2016). Foi estabelecido que o gene DMRT3 é um dos mais importantes genes na determinação do padrão de locomoção, relacionado com a coordenação dos membros torácicos e pélvicos (ANDERSSON ET AL., 2012; JÄDERKVIST ET AL., 2014). Estudos anteriores mostraram que há uma forte relação entre a qualidade da marcha e a variante do gene DMRT3 (ANTIKAS, 2005). Nas raças marchadoras de equinos se correlacionou a variante deste, um polimorfismo único em nucleotídeo (22999655C>A) que provoca um códon de parada prematuro e resulta em uma proteína inacabada, com o tipo de andamento marchado (FONSECA ET AL., 2017) 4 Uma vez que a produção do híbrido descende da fêmea equina, possivelmente marchadora, e que a marcha de asininos e muares é classificada de maneira similar a dos equinos, este estudo objetivou avaliar a correlação entre a presença da variante acima citada e o tipo de andamento apresentado por asininos e muares. O desenvolvimento de metodologia de genotipagem desta variante permitirá a sua utilização pelos criadores e profissionais na aquisição de animais e no direcionamento dos acasalamentos com intuito de selecionar animais com determinado tipo de marcha. Sendo assim, os resultados trarão benefícios para subsidiar futuros estudos epidemiológicos sobre o assunto além de apresentar aplicabilidade. 5 2. Revisão de Literatura 2.1Asininos e Muares Há seis mil anos, no início de sua domesticação os asininos (Equus asinus) foram utilizados como fonte de alimento, e menos de um milênio depois já estavam sendo utilizados para transporte de cargas pesadas. Contudo, sobretudo pela sua grande adaptabilidade a regiões áridas e por sua capacidade de carga, os asininos passaram a desempenhar um importante papel no transporte de cargas pesadas e na distribuição de alimentos em larga escala em territórios da África e antigo Egito (ROSSEL et al., 2008). A utilização de equídeos revolucionou a produção agrícola e de alimentos, sendo os asininos um destaque em sua capacidade de carga, capazes de percorrer distâncias de até 40km/dia carregando até 65% de seus peso vivo, bem acima do cavalo com o equivalente de 45% de seu peso vivo em distâncias de até 30km/dia (CEPEA, 2006). Os asininos chegaram ao Brasil trazidos pelos colonizadores por volta de 1534 (MARIANTE E CAVALCANTE, 2006) provavelmente originários de linhagens portuguesas, espanholas e africanas (TORRES E JARDIM, 1992). Destes se originaram as três raças de asininos nacionais: jumento Pêga, jumento Nacional e jumento Nordestino. (MARIANTE E CAVALCANTE, 2006). Acredita-se que o jumento Brasileiro tenha origem no cruzamento de jumentos italianos e ibéricos (CARNEIRO, 2018) e a raça Pêga de origem essencialmente ibérica. Estudos mais recentes utilizando análise de DNA mitocondrial demonstram essa proximidade entre as duas raças citadas e seu distanciamento genético da raça jumento Nordestino (ALMEIDA, 2009). Desde sua introdução no país, esses animais foram amplamente utilizados para produção e transporte no setor agropecuário, principalmente nas regiões semiáridas. E são considerados como parte da herança cultural, social, econômica e ecológica do Brasil e de toda América do Sul (CARNEIRO, 2018). Embora, o avanço da mecanização do campo tenha colocado em xeque a utilidade destes animais, sobretudo, nas regiões semiáridas do Nordeste brasileiro (Figura 1). Entretanto, os jumentos das raças Pêga e Brasileiro, ainda mantêm certo destaque no Sudestes e Centro-Oeste brasileiro, sobretudo no 6 acasalamento com equinos (Equus caballus) e a consequente produção de muares, principalmente burros e mulas (Oliveira, 2004; Ribeiro, 2017). Figura 1. Imagem representando asinino sendo usado para transporte de carga no interior do estado da Bahia. Tirada em julho de 2016 (Fonte: Acervo Pessoal) Além de fonte de alimento e utilização na agricultura e transporte os asininos também são largamente utilizados na produção de híbridos com os equinos (Equus caballus). Dentre eles podemos citar os muares (Figura 2) (burros e mulas) fruto do acasalamento entre a égua e o jumento (Figura 3) e os bardotos fruto do acasalamento da jumenta (Figura 4) com o garanhão equino (RIBEIRO, 2017). 7 Figura 2. Imagem representando uma égua com um muar ao pé. (Fonte: Acervo Pessoal) Figura 3. Imagem de Jumento macho (asinino) utilizado comercialmente na produção de híbridos marchadores.(Fonte: Criatório Campeãs da Gameleira. Fotógrafa: Neide Weingrill) Figura 4. Imagem de Jumenta fêmea com jumento ao pé. (Fonte: Acervo Pessoal) 8 A produção dos híbridos também é datada desde os tempos do antigo egito (RIBEIRO,2017) e têm destaque importante na história do país por serem o meio de transporte dos tropeiros, considerados desbravadores do Brasil, que interligavam as regiões sul e sudeste do país e sendo parte essencial do ciclo do ouro e do café na rota para exportação (GRUBER, 2016) além de sua importância como patrimônio cultural (ALMEIDA, 2009). No Brasil, o “ciclo do muar” teve início no século XVII (ELIS, 1950), época em que a economia da mineração dependia do transporte de animais de carga para fluxo constante (SUPRINYAK, 2006). A principal característica que desponta desse cruzamento é a criação de um animal maior que o asinino porém ainda rústico e resistente (COSTA, 2005), com grande capacidade de carga e facilidade para caminhar em solos acidentados e íngremes (BORGES, 2016). Desta forma, se formou e consolidou-se um avançado sistema de comercialização destes animais (SUPRINYAK, 2006). Com a expansão de estradas ferroviárias, durante o Brasil imperial, o mercado muar perdeu sua magnitude, porém a cultura do tropeiro é mantida até hoje. Longas cavalgadas são cada vez mais populares e a tendência de utilizar muares em detrimento de cavalos está cada vez maior. Os muares ganharam espaço na equideocultura, apresentaram resultados positivos em vários segmentos como tração, apartação, trabalho, provas morfológicas, provas funcionais, concurso de marcha, esportes e cavalgadas (Ellis, 1950). A seleção dos asininos se dá em cima das características desejáveis para a finalidade a qual se propõe, o jumento Brasileiro e o jumento Pêga têm como principal finalidade a produção de muares de sela, sendo composto por animais sobretudo marchadores. Devido a maior exigência por animais de marcha confortável para percorrer longas distâncias e em baixa velocidade, a seleção desses muares de sela marchadores tem sido a partir do cruzamento de asininos marchadores das raças Pêga e Brasileira com equinos preferencialmente das raças Mangalarga e Campolina (Torres & Jardim, 1992). De acordo com a Associação Brasileira dos Criadores do Cavalo Mangalarga Marchador (ABCCMM) o andamento marchado é caracterizado como um andamento natural, simétrico, a quatro tempos que alterna os bípedes laterais e diagonais intercalando com momentos de tríplice apoio. No 9 cavalo mangalarga machador já foram bem estabelecidos dois padrões de marcha, a marcha batida e a marcha picada (FONSECA, 2017), os mesmos padrões de marcha aceitos pela Associação Brasileira de Criadores de Jumento Pêga em seu padrão da raça de asininos e muares. Sendo a principal característica da marcha picada a prevalência de bípedes laterais na passada, se assemelhando a andadura, e na marcha batida o predomínio da passada diagonalizada (PROCÓPIO, 2005). Essa importância e ascensão dos asininos e muares marchadores pode ser notada uma vez que vêm sendo alvo da mídia devido ao valor agregado a elas. Já que as melhores mulas, também chamadas de mulas de patrão, podem ser estimadas em valores entre R$20.000,00 e R$100.000,00 (TV TEM -GLOBO, 2018). A crescente utilização desses animais também justificou a criação de uma revista derivada da revista Horse, chamada Muladeiros, que em janeiro de 2019 publicou a sua décima edição. Além de um evento dentro do parque de Barretos chamado Barretos Muar do Sertão que em 2018 teve seu quinto encontro, no qual foram realizadas provas de marcha e morfologia, além de cavalgada pela cidade, de acordo com o site dos Independentes que são responsáveis pelo evento. 2.2Andamento Os equídeos possuem andamentos dissociados e suas variações (Manso Filho et al., 2015). Segundo a Associação Brasileira dos Criadores do Cavalo Mangalarga Marchador (ABCCMM) o andamento marchado é caracterizado como um andamento natural, simétrico, a quatro tempos que alterna os bípedes laterais e diagonais intercalando com momentos de tríplice apoio. No Mangalarga Machador já foram bem estabelecidos dois padrões de marcha, a marcha batida e a marcha picada (Fonseca, 2017). Sendo estes, os mesmos padrões de marcha aceitos pela Associação Brasileira de Criadores de Jumento Pêga. Sendo a principal característica da marcha picada a prevalência de bípedes laterais na passada (Figura 5), se assemelhando a andadura, e na marcha batida o predomínio da passada diagonalizada (Figura 6) (PROCÓPIO, 2005). 10 Figura 5. Jumento apresentado bípedes laterais na passada. (Fonte: acervo pessoal) Figura 6. Jumenta apresentando movimento bipedal diagonalizado (A) seguido de tríplice apoio (B) evidenciado pela seta vermelha no membro em suspensão. (Fonte: acervo pessoal) A marcha batida é definida por um andamento simétrico, marchada, de ritmo irregular a quatro tempos, com acoplamento diagonal e diagrama composto por alternância de apoios diagonais e quadrupedal intercalados por momentos de tríplice apoio, sem ocorrência de apoio lateral. Já a marcha picada é simétrica, marchada, de ritmo regular a quatro tempos, com diagrama composto por apoios alternados dos bípedes laterais e diagonais intercalados por momentos de tríplice apoio (Nicodemus & Clayton, 2003). 11 2.3Gene DMRT3: “doublesex and mab-3 related transcription factor 3” Estudos anteriores mostraram que há uma forte relação entre o tipo da marcha e a variante do gene DMRT3, em um estudo o autor Staiger tentou determinar a origem da variante, entretanto, não foi possível determiná-la com certeza (Antikas, 2015). Conclui-se de que a origem geográfica da variante do Gait keeper só pode ser esclarecida se os estudos do antigo DNA demonstrarem que as primeiras variante se tornaram abundantes em uma específica área geográfica. Em um estudo recente de DNA antigo mostrou que a variante estava presente na era medieval na Inglaterra e na Islândia e os autores argumentaram que a variante pode ter originado na Inglaterra (Wutke et al. 2016) .Entretanto, uma vez que nesse estudo não foram incluídos cavalos antigos da Ásia para o período crítico de 0 a 800 dC, e apenas dois cavalos do sul da Europa do mesmo período, é totalmente possível que a variante tenha surgido em outro lugar e foi trazido para a Inglaterra. Por exemplo, Plínio, o Velho (23–79 dC), observou que os cavalos da Região das Astúrias, no norte de Espanha, moviam ambas as pernas o mesmo lado alternadamente e não trotavam (Viluma., 2012), sugerindo que a variante já estava presente na Europa 2000 antes de cristo. Andersson et al. (2012) demonstraram que o gene doublesex and mab-3 related transcription factors (DMRT3) desempenha papel fundamental na configuração dos circuitos espinhais, controlando assim o tamanho da passada em vertebrados. Os mesmos autores atribuem que a variante chr23:g.22999655C>A, neste gene, teve um importante efeito na diversificação do cavalo doméstico, assim como, atribuindo a caracterização dos tipos de marchas nas diferentes raças de equinos. A variante DMRT3_chr23:g.22999655C>A causa um prematuro códon de parada (DMRT3_Ser301STOP) no codón 301 do gene DMRT3, consequentemente há a produção de uma proteína truncada, com a perda de 174 aminoácidos. Portanto, o gene DMRT3 é um dos mais importantes genes relacionados ao “Gait keeper”, ou seja, relacionado com a coordenação dos membros torácicos e pélvicos durante a locomoção (Andersson et al., 2012; Jäderkvist et al., 2014). Sabe-se que a variante permite o andamento lateralizado, também havendo maior favorecimento da velocidade ao trote e inibição à transição do trote ao galope (Andersson et al., 2012). A genotipagem de 4.396 cavalos para 12 a variante no DMRT3, demonstrou que esta variante tem distribuição mundial e está presente em 68 das 141 raças de cavalos avaliadas no estudo, além disso, as raças com alta frequência do polimorfismo (>50%) ou eram raças marchadoras ou de “atrelagem” (Promerová et al., 2014). Outros estudos também relacionaram a presença do genótipo AA com cavalos marchadores (Jäderkvist et al., 2014; Kristjansson et al., 2014; Promerová et al, 2014; Han et al., 2015; Novoa-Bravo, 2019). No Brasil, observou-se uma frequência alélica maior também em raças de marcha (Manso Filho et al., 2015). Por outro lado, Pereira et al. (2015) sugeriram que que o alelo AA é um fator limitante para cavalos Quarto de Milha de corrida, corroborando com Ricard (2015) que também apontou o efeito negativo da variante nas características associadas a corrida. O genótipo AA proporciona maior suporte à coordenação ipsilateral de membros, com efeito negativo ao movimento diagonal sincronizado, quando comparado ao genótipo CA (Kristjansson et al., 2014). Outro estudo avaliou cavalos marchadores islandeses em liberdade e conclui-se que, apesar de cavalos wildtype (CC) poderem apresentar a marcha denominada tölt, cavalos afetados para a variante apresentavam maior facilidade de andamento lateralizado para realizar o tölt e apresentavam o movimento em maior frequência do que animais não afetados (Jäderkvist et al., 2015). Manso-Filho et al (2015), evidenciaram a maior frequência do alelo C (85%), observado apenas em homozigose (23/27), em Mangalargas Marchadores que apresentavam marcha batida (diagonal), enquanto que, nos animais com marcha picada (lateral), o alelo A foi predominante (81%), sendo observado em heterozigose (17/26) e em homozigose (8/26) no Mangalargas Marchadores avaliados. Patterson et al. (2015) também observaram o predomínio dos alelos C (97%) e A (65%) em Mangalargas Marchadores que apresentavam marchas batida e picada, respectivamente. Contudo, estes autores sugerem que a pressão de seleção pelo tipo de marcha tenha alterado a frequência alélica no Mangalarga Marchador. Sabe-se que há outros genes envolvidos com o padrão de marcha lateralizado (Patterson et al., 2015; Jäderkvist , 2017; Amano, 2018). Neste sentido, Fonseca et al. (2017) demonstraram pela primeira vez, em cavalos da raça Mangalarga Machador, que, ao contrário da marcha picada 13 (lateralizada), a qual é controlada pelo alelo A do gene DMRT3, a marcha batida (diagonalizada) pode ser controlada por um grupo de genes. 14 3. Objetivo O objetivo deste trabalho é verificar a frequência alélica da variação no gene DMRT3, no qual há o SNP (single nucleotide polymorphism) de uma citosina por uma adenina (22999655C>A), em mulas e asininos marchadores no Brasil, e, caso haja relação, associar ao padrão de andamento (marcha batida ou picada). 15 4. Material e Métodos Este projeto é desenvolvido nas dependências do Laboratório de Biologia Molecular da Clínica Veterinária (LBMCV) da Faculdade de Medicina Veterinária e Zootecnia (FMVZ) – Unesp. O LBMCV é equipado com todos os equipamentos necessários para realização do teste genético, com exceção do sequenciador 3.500 Genetic Analyzers (Applied Biosystems) ou similar, sendo necessário a contratação de serviços de terceiros para realização desta parte do experimento. 4.1Comitê de ética Todos os protocolos foram aprovados pelo Comitê de Ética e Experimentação Animal da FMVZ/ Botucatu, SP. Aprovado em 26 de maio de 2020 (64/2020-CEUA-UNESP). 4.2Seleção dos animais e coleta Baseado no número de muares e asininos registrados na Associação Brasileira do Jumento Pêga (ABCJPêga) e usando a ferramenta Survey Monkey com uma margem de erro de 5% e um intervalo de confiança de 95%, um total de 203 jumentos (Equus asinus) e 159 mulas foram analizados nesse estudo. As amostras foram obtidas na região Sudeste e Centro-Oeste do Brasil. Todos os animais foram classificados quanto ao tipo de marcha, picada ou batida, por um mesmo avaliador experiente e de acordo com as regras da associação. O DNA genômico foi purificado dos bulbos de pêlo e armazenados a -80°C até processamento molecular. 4.3 Sequenciamento do gene DMRT3 dos jumentos O objetivo foi sequenciar o DNA genômico correspondente ao mRNA do gene DMRT3 dos asininos. Para sequenciar os dois exons do gene DMRT3 do jumento, amostras de DNA de 20 jumentos machos (10 de marcha batida e 10 de marcha picada) foram utilizadas. Para incluir uma maior diversidade na análise os animais em questão não tinham filiação similar. Uma reação de polimerase em cadeia (PCR) foi realizada utilizando primers específicos desenhados para amplificar a sequência codificante completa (dois exons) e as 16 junções intron-exon 5’ e 3’. As reações foram padronizadas para um volume final de 30μL, contendo 2,5 μL do DNA, 15μL da enzima GoTaq® Green Master Mix (PromegaTM), 0,6μL de cada um dos primers e 11,3μL de água “nuclease- free”. A programação de termociclagem inicialmente testada para todas as reações de PCR será de 95°C por 5 min, seguida por 40 ciclos de 95°C por 45 s, 60°C por 30s e 72°C por 2 min e extensão final de 72°C por 5 min. Os produtos do PCR foram purificados e submetidos para o sequenciamento Sanger. As sequências obtidas e os eletroferogramas foram avaliados utilizando o software Geneious® (Biomatters©, Auckland, New Zealand) e foram comparados com os sequenciamento gênico do gene DMRT3 da espécie equina (Equus caballus) encontrada no GenBankTM NC_009166.3:22378399-22378896 e também à sequência XM_044756984.1 do gene previsto DRMT3 dos asininos (Equus asinus). 4.4 Genotipagem dos animais por PCR-RFLP Nesse trabalho o gene DMRT3:g.22999655C>A SPN foi genotipado nas amostras de DNA de jumentos e muares usando enzimas de restrição (RFLP - Restriction Fragment Length Polymorphism). Inicialmente foram utilizadas amostras de equinos Mangalarga Marchador para a variante DMRT3 pelo sequenciamento Sanger para identificar animais com os três diferentes genótipos (CC, CA e AA). O controle de cada genótipo foi utilizado para a padronização do PCR-RFLP. O DNA foi purificado à partir do sangue ou bulbo de pelo de mulas e jumentos e armazenado à -20°C. O PCR (25 μL) foi realizado com 2.5 μL de DNA, 0.4 μM ode cada kit de primers DMRT3_LBMCV_DdeI, 12.5 μL de PCR Master Mix (Promega, CA, USA), and 8.5 μL de água nuclease-free. A condições de amplificação foram: desnaturação inicial 95°C por 5 min, seguida por 40 ciclos de 95°C por 45 s, 60°C por 60s e 72°C por 2 min e extensão final de 72°C por 5 min. Imediatamente após para rápida detecção do DMRT3_g.22999655C>A SNP os produtos de PCR foram clivados usando enzimas de restrição Ddel (Promega, CA, USA). As misturas de reação de RFLP continham 7.3 μL de água “nuclease-free”, 10 μL do produto de PCR, 0.2 μL de albumina bovina, 2 μL de 10X buffer de reação, e 5u de DdeI enzyme. As reações foram realizada à 37°C por 30 minutos. As reações foram realizadas a 17 37 °C for 30 min. E o produto analisado através de eletroforese em gel de agarose 2%. Em seguida, foi realizado o sequenciamento Sanger para o DMRT3 SNP para validar os resultados do PCR-RFLP usando produtos de PCR antes da clivagem. 4.5 Forma de análise dos resultados Para a análise da prevalência das enfermidades uma população aleatória será utilizada, com a finalidade inicial de determinar a prevalência e suportar futuros estudos epidemiológicos. A frequência alélica e erro padrão serão calculados, respectivamente, através das contas: 18 5. Resultados e Discussão 5.1Resultados Avaliação da sequência codificante do gene DMRT3 dos jumentos A sequência do mRNA do gene DMRT3 obtida do jumento Pêga foi depositada no GenBankTM (OP068195.1). Ao total de 16 conjuntos de primers foram utilizados a fim de amplificar a sequência codificante do gene DMRT3 do jumento, destes, três pares para amplificação do Exon 1 e outros três pares para amplificação do Exon 2 (Tabela 1). Utilizando estes pares de primers e o DNA sanguíneo de 30 jumentos (16 jumentos de marcha batida e 14 de marcha picada) obteve-se a sequência da região intrônica do gene DMRT3 asinino e comparou-se com a sequência do gene DMRT3 obtida do Equus caballus isolate Twilight breed thoroughbred chromosome 23, EquCab3.0 (GenBankTM NC_009166.3:22378399-22378896). Tabela 1. Primers usados na amplificação da sequência codificante do gene DMRT3 em jumentos (Equus asinus) e para detecção da variante DMRT3_chr23:g.22999655C>A Primers Sequências Produto (pb¹) Temperatura de anelamento JP_DMRT3_EXON1_8 5’- AAAGACGGGTGCCGCAT -3’ 5’- GTAGCGCTTGTGACCCTTGA -3’ 315 64 ºC JP_DMRT3_EXON1_9 5’- GCTTCAAGGACTGCACCT -3’ 5’- TTCTGCCCGGAAAGAACC -3’ 479 62 ºC JP_DMRT3_EXON1_1 0 5’- CTGGCTCAAGGGTCACAAG -3’ 5’- AGGCCAACTTCCGAAACC -3’ 457 62 ºC JP_DMRT3_EXON2_3 5’- CATTTGCCAGTGACATAGTTTGG -3’ 5’- CAAGCTGAAGGGCAGAGAAA -3’ 454 59 ºC JP_DMRT3_EXON2_4 5’- CAGAGACCTTCAGCGACAAA -3’ 5’- GTCATCCTCGGTGTAAAGAGAC -3’ 866 62 ºC 19 JP_DMRT3_EXON2_5 5’- GCAGACTCTAGTAACGTTGTCC -3’ 5’- CCCAGCTTTCCCAAGACTATT -3’ 666 62 ºC DMRT3_LBMCV_Ddel 5’- ACAGAGACCTTCAGCGACAA -3’ 5’- GGGTTGGGGACAACGTTACT -3’ 560 60 ºC ¹Pares de base Excluindo as sobreposições, as sequências obtidas somaram um total de 2.212 pares de bases (pb) (Figura 7), sendo compostos por: 135 pb do intrón prévio ao 5’ - UTR; 498 pb do exón 1, sendo 38 pb da 5’ - UTR e 460 pb da região codificante do exón 1; 164 pb da porção inicial do intrón posterior ao exón 1; 173 pb da porção final deste intrón; 1.241 pb do exón 2, sendo 965 pb da região codificante do exón 2 e 276 pb da região 3’ - UTR do exón 2. Ao se comparar a sequência do gene DMRT3 asinina com a equina observou-se a presença de cinco SNP (single nucleotide polymorphism) (Figura 1): c.627C>G, c.966A>C, c.1131T>C, c.1137A>G e c.1251G>A. Embora estes SNP tenham sido detectados na região codificante do exón 2, os mesmos não alteravam a sequência de aminoácidos previamente descrita nos equinos (p.209Val, p.322Ser, p.377Tre, p.379Ala, p.417Ser). Além disso, um SNP foi observado no exón 1 (A/G) 5 bases antes do códon de iniciação na região 5’- UTR. A sequência codificante do DMRT3 asinina foi depositada no GenBankTM (OP068195.1). aaagacgggtgccgcatctctggccagcccggagcgcacgcggccgccggagctgcgggaccaaggac cgcgccgtccggaggccgcccctgagcgcgcctcccagccccgccgtccagcgccccctggcccgctcC CGCCGCCAGCCCGCCAGCTCTTCCGGGAGCTC(A/G)GGGCATGAACGGC TACGGTTCCCCCTACCTGTACATGGGCGGCCCGGTGTCGCAGCCGCCGCG GGCGCCCTTGCAGCGCACGCCCAAGTGCGCGCGCTGCCGCAACCACGG GGTGCTGTCCTGGCTCAAGGGTCACAAGCGCTACTGCCGCTTCAAGGACT GCACCTGCGAGAAGTGCATCCTCATCATCGAGCGGCAGAGGGTCATGGCG GCGCAGGTGGCGCTGCGCCGGCAGCAAGCTAACGAGAGCCTCGAGAGCC TCATTCCCGACTCGCTGCGTGCTCTGCCCGGCCCCCCGCCGCCGGGGGA CGCCGCCGCTGCCGCCCCGCAGCCGCCGCCCACCTCGCAGCCGTCTCA GCCGCCGCCGCCGCAGCGTCCCGCCGCCGAGTTGGCTGCGGCTGCCGC 20 GCTGCGCTGGGCCACCGAGCCGCAGCCCGGGGCGCTGCAGGCGCAGCT CGCCAAGCCAGgtaagagcttccgcggggcgggcgccaggccaggcgcgtgggcgcaaaaacttc ggagctcttgctgcggctctgcttgggaggcctggaggcaaggtttcggaagttggcctggccgggccttcctc cccaatccccggcaagccggttctttccgggcagaaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxcatttgccagtgacatagtttggattttttttttttttaa ggcttgcactatgttataacccactgagatgcatttctccttccaagaagcctgtgtggggctctcctgagcacat ctgttcccttttatgcacaccaggaaaggattaacccagctgttctctgctttccagATTTGACTGAGGAG CGACTTGGGGACGGCAGCTCCGCAGACAACACAGAGACCTTCAGCGACA AAGACACCGACCAGAGGAGCTCCCCAGATGTGGTGAAAAGTAAGGGCTGC TTCACCCCGGAGAGCCCCGAGGTCGTGTCTGTGGATGAAGGCGGGTATGC GGT(C/G)CAGAAGAACGGAGGCACCTCCGAGAGCCGCCCCGACAGTCCC AAGTACCACGGGGAACAGAATCACCTCCTGATCGAGGGCCCCTCGGGGAC CGTTTCTCTGCCCTTCAGCTTGAAAGCCAACAGACCGCCCCTGGAAGTGT TAAAAAAAATCTTCCCCAACCAGAAGCCCACGGTGCTGGAGCTCATCCTGA AGGGCTGTGGGGGCGACCTGGTGAGCGCCGTGGAGGTCCTCCTCTCCAG CCGCTCCTCGGCCTCGGCCGCCGACCGAACTTCGGCAGAGCCCGAGAGC CTCGTGTTGCCCTCCAACGGGCACATCTTTGAACACACCTTGAGCTC(A/C) TACCCCATCTCCTCTTCCAAATGGTCCGTGGGATCGGCCTTCAGGGTCCCA GACACGTTGAGGTTTTCCGCAGACTCTAGTAACGTTGTCCCCAACCCCTTG GCCGTGCCCCTGCAGCATCCTTTCCCCCAGCCGCCCCGGTACCCTCTGAT GCTGAGGAATAC(T/C)TTGGC(A/G)AGAAACCAGTCGAGCCCCTTCCTGCC CAATGATGTCACCCTGTGGAACACCATGACGCTGCAGCAGCAGTACCAGCT GAGGTCCCAGTACGTCAGCCCTTTCCCCGGGAGCTC(G/A)CCCAGCGTCT TCAGAAGCTCGCCTGTCCTTCCCACGCGCGCCCCCGAAGACCCTCGGATC TCCATCCCTGACGATGGGTGTCCGATTGTGTCAAAGCAGTCTCTTTACACC GAGGATGACTATGACGAGAGGTCCGACTCCTCAGACTCTAGAATACTCAAC ACATCATCTTAAAGTGGTACCGGGTGGCTGGTGACCAGGTGACATTTTCTG TGCATTTGAACTCTGACCCCCTGCCCTCCCCAGGAGAGGCCTCGTCCTGT GTATACCCTTTCCTTCTGTTTGACAAAGTGACTGTGCTTGATTCTATACCTTA GCAATAAAAACATAACTTATTTAATTTCTTGCACTTCACTGGAAAATGCCAAAT AGCTCTGCTCTGCGGCTTTAGTGCTGAATGTTTATTGTAAAAGAGAGTCTAA TGCTAAGAATAGTCTTGGGAAAGCTGGG 21 Figura 7. Sequência codificante do gene DMRT3 obtida do Equus caballus isolate Twilight breed thoroughbred chromosome 23, EquCab3.0 (GenBankTM NC_009166.3:22378399-22378896). As sequências intrônicas e exônicas são representadas por letras minúsculas e maiúsculas, respectivamente. Os códons ATG (start códon) e TAA (stop códon) estão grafados em negrito, enquanto que, a variante DMRT3_chr23:g.22999655C>A em vermelho. Sequências dos primers estão destacadas em cores: em amarelo, EXON1_8; em vermelho, EXON1_9; em azul, EXON1_10; em verde, EXON2_3; em rosa, EXON2_4; em cinza, EXON2_5. A sequência de letras “x” se refere a parte do intrón 2 que não foi sequenciada. As diferenças entre as sequências do gene DMRT3 asinina e do Equus caballus estão em negrito e em parênteses. Uma vez que os três genótipos (CC, C/A e AA) já haviam sido descritos em equinos da raça Mangalarga Marchador, optou-se pela utilização de amostras de DNA de equinos dessa raça para a padronização da RFLP. A padronização da RFLP com a enzima de restrição Ddel possibilitou a identificação por eletroforese dos três genótipos (C/C, banda de 560 pb; C/A, bandas de 560, 395 e 165 pb; e A/A, bandas de 395 e 165 pb) (Figura 8). Esses genótipos foram confirmados por sequenciamento de Sanger (Figura 9). A genotipagem de todas as amostras foi realizada por RFLP e confirmadas por sequenciamento de Sanger. Figura 8. Gel de agarose a 2% mostrando a corrida eletroforética de RFLP para genotipagem da variante DMRT3_chr23:g.22999655C>A. Observa-se, Low Ladder de 100 pb; C/C, muar homozigoto wild type com a presença de 22 uma única banda de 560 pares de bases (pb); C/A, muar heterozigoto com a presença de três bandas de 560, 395 e 165 pb); A/A, equino homozigoto para variante com a presença de duas bandas com 395 e 165 pb); CN, controle negativo (amostra sem DNA) sem a visualização de bandas eletroforéticas. Figura 9. Cromatogramas parciais mostrando os resultados do sequenciamento capilar de homozigoto wild type (A), heterozigoto (B) e homozigoto mutado (C) da variante DMRT3_chr23:g.22999655C>A. Alelo wild type (citosina) e o respectivo aminoácido serina (seta azul), pico duplo (citosina e adenina) e o respectivo aminoácido serina ou o stop códon (seta verde), alelo mutado (adenina) e o stop códon (TAG) (seta vermelha). Imagem obtida usando o Genious® 10.0 software (Biomartters Ltd., Auckland, Nova Zelândia). Foram selecionados 159 muares, os quais foram classificados segundo o andamento batido (n = 99) e picado (n = 60). Os genótipos C/C e C/A foram observados em 47% (75/159) e 53% (84/159) dos muares, respectivamente, enquanto que o genótipo A/A não foi evidenciado em nenhum dos animais avaliados. Portanto, a frequência do alelo A no grupo de muares avaliados no presente estudo, independentemente da marcha, foi de 0,264 ±0,025. 23 Os 203 jumentos foram classificados segundo o andamento batido (n = 101) e picado (n = 102). O genótipo C/C foi predominante observado nos jumentos avaliados neste estudo (97%, 196/203), enquanto que sete (3%, 7/203) jumentos eram heterozigotos (C/A) para variante DMRT3_chr23:g.22999655C>A. Nenhum dos jumentos avaliados era homozigoto mutado (A/A) (Tabela 3). Portanto, a frequência do alelo A no grupo de asininos avaliados no presente estudo, independentemente da marcha, foi de 0,017 ±0,006. Ao se avaliar o genótipo de acordo com o fenótipo dos animais, observou-se que os genótipos C/C e C/A foram identificados em 99 e 1%, respectivamente, entre os animais de marcha batida; e 94% e 6%, respectivamente, entre os animais classificados com a marcha picada (Tabela 2). Ao se avaliar a distribuição dos genótipos CC e CA de acordo com a marcha, observou-se o predomínio do genótipo CC tanto no grupo de jumentos com marcha batida (P < 0,001) quanto no de marcha picada (P < 0,001). Além disso, a presença do genótipo CC foi igual (P = 0,905) independentemente do tipo da marcha, batida (100/196, 51%) ou picada (96/196, 49%). Diferentemente, o genótipo CA estava mais presente (P < 0,001) em jumentos com a marcha picada (6/7, 86%) do que aqueles de marcha batida (1/7, 14%). Tabela 2: Distribuição dos genótipos (C/C, C/A e A/A) da variante DMRT3_chr23:g.22999655C>A de acordo com o fenótipo (marchas batida ou picada) em 159 muares. Tipo de Marcha Genótipos Batida Picada Total C/C 46 (46%) 29 (48%) 75 (47%) C/A 53 (54%) 31 (52%) 84 (53%) A/A ND* ND* Total 99 60 159 *ND, não detectado. 24 Tabela 3: Distribuição dos genótipos (C/C, C/A e A/A) da variante DMRT3_chr23:g.22999655C>A de acordo com o fenótipo (marchas batida ou picada) em 203 jumentos. Tipo de Marcha Genótipos Batida Picada Total C/C 100 (99%) 96 (94%) 196 (97%) C/A 1 (1%) 6 (6%) 7 (3%) A/A ND ND ND Total 101 102 203 *ND, não detectado. 5.2Discussão As sequências do gene DMRT3 asinina e equina são análogas, sendo observadas nos asininos cinco SNP silenciosos em região codificante (c.627C>G, c.966A>C, c.1131T>C, c.1137A>G e c.1251G>A), ou seja, estes SNP não alteram a sequência de aminoácidos previamente descrita nos equinos (p.209Val, p.322Ser, p.377Tre, p.379Ala, p.417Ser). A sequência do Equus caballus (GenBankTM NC_009166.3:22378399-22378896) utilizada na comparação com a sequência do Equus asinus foi obtida de forma automática e, portanto, não se pode dizer que os SNP observados no presente estudo também não ocorram nos equinos. Desde que a variante DMRT3_chr23:g.22999655C>A foi relacionada com a coordenação dos membros torácicos e pélvicos durante a locomoção (Andersson et al., 2012; Jäderkvist et al., 2014), alguns autores padronizaram a genotipagem de equinos para a referida variante utilizando diferentes técnicas, e.g., TaqMan SNP (Andersson et al., 2012; Jäderkvist et al., 2014; Promerová et al., 2014), sequenciamento gênico (Manso Filho et al., 2015) e por RFLP (Patterson et al., 2015; Pereira et al., 2016; Regatieri et al., 2016). Assim como estudos prévios (Patterson et al., 2015; Pereira et al., 2016; Regatieri et al., 2016) que utilizaram a enzima de restrição Ddel, o presente estudo padronizou 25 a PCR-RFLP em muares utilizando sets específicos de primers e a enzima Ddel. No presente estudo, essa metodologia foi capaz de diferenciar os genótipos avaliados e foi validada pelo sequenciamento de Sanger, portanto, é um teste barato e rápido que pode ser empregado para avaliar a presença de alelos mutados em equídeos e assim propiciar a orientação dos acasalamentos a fim de favorecer a escolha do andamento desejado. Os equídeos possuem andamentos dissociados e suas variações (picada, batida, de centro ou intermediária e trotada) (Manso Filho et al., 2015). Utilizando as normas da ABCJPêga, os muares e asininos do presente estudo foram agrupados de acordo com o seu padrão de andamento natural, em marcha batida ou picada, ou seja, não foi levada em consideração a interferência do cavaleiro ou domador no andamento, uma vez que, os muares podem se adaptar ao tipo de marcha exigida pelo cavaleiro com treinamento. Devido a maior exigência por animais de marcha confortável para percorrer longas distâncias e em baixa velocidade, a seleção dos muares de sela marchadores tem sido a partir do cruzamento de asininos marchadores das raças Pêga e Brasileira com equinos preferencialmente das raças Mangalarga e Campolina (Torres & Jardim, 1992). Embora o genótipo AA proporcione maior suporte à coordenação ipsilateral de membros, com efeito negativo ao movimento diagonal sincronizado, quando comparado ao genótipo CA ou CC (Kristjansson et al., 2014) o que beneficiaria o tipo de marcha picada, no presente estudo não se observou a presença de muares e nem asininos homozigotos AA. Além disso, o genótipo CA foi observado em baixa prevalência no grupo de asininos (3%, 7/203) avaliados no presente estudo, sobretudo, quando se compara com a frequência deste genótipo nos muares (53%, 84/159). Diante disso, a frequência do alelo A no grupo de muares e jumentos, independentemente da marcha, foi de 0,264 ± 0,025 e 0,017 ± 0,006, respectivamente. Diferentemente do que foi observado no presente estudo, onde os genótipos C/C e C/A encontravam-se distribuídos de forma similar tanto no grupo de mulas com marcha batida (P = 0,484) quanto no grupo com marcha picada (P = 0.749), Manso-Filho et al. (2015) evidenciaram apenas o genótipo C/C em Mangalargas Marchadores que apresentavam marcha batida, enquanto que, nos animais com marcha picada, o alelo A foi predominante, sendo observado 26 heterozigose e em homozigose. Patterson et al. (2015) também observaram o predomínio dos alelos C e A em Mangalargas Marchadores que apresentavam marchas batida e picada, respectivamente. O número de muares genotipados no presente estudo (159) foi superior aos números de cavalos genotipados para a variante DMRT3_chr23:g.22999655C>A por Manso-Filho et al. (2015) (n=105) e Patterson et al. (2015) (n=81) e o resultado obtido é que a referida variação não tem relação com a marcha nos muares. Embora tenha sido observado o predomínio do genótipo CC tanto no grupo de jumentos com marcha batida (P < 0,001) e picada (P < 0,001), o genótipo CA estava mais presente (P < 0,001) em jumentos com a marcha picada (6/7, 86%) do que aqueles de marcha batida (1/7, 14%). Sendo assim, mesmo ressalvando-se a ausência de jumentos AA e o baixo número de jumentos CA, a maior presença desse genótipo nos jumentos com a marcha picada corrobora com os achados de Manso-Filho et al. (2015) e Patterson et al. (2015) em cavalos Mangalargas Marchadores. O fato de os três genótipos já terem sidos descritos no Mangalarga e Campolina (Manso-Filho et al., 2015; Patterson et al., 2015), principais raças envolvidas na produção comercial de mulas no Brasil, somado a maior porcentagem de muares heterozigotos observados nos muares e a baixa presença do alelo mutado na população de jumentos avaliada no presente estudo, permitem especular que o alelo variante observado em heterozigose nestas mulas foi herdado, sobretudo, da égua utilizada no cruzamento com os jumentos. Além disso, os resultados do presente estudo sugerem que, o tipo de marcha, picada ou batida, não foi influenciado pela referida variante no grupo de muares ou asininos avaliados. Por fim, a genotipagem padronizada por RFLP no presente estudo foi capaz de diferenciar os genótipos avaliados e, portanto, é além de ser um teste barato e rápido poderá ser empregada na orientação dos acasalamentos, a fim de favorecer a escolha do andamento desejado. 27 6. BIBLIOGRAFIA ALMEIDA, L.D. Diversidade genética de raças asininas criadas no Brasil, baseada na análise de locos microssatélites e DNA mitocondrial. Brasília: Faculdade de Agronomia e Medicina Veterinária, Universidade de Brasília,2009, 83p. Dissertação de Mestrado. ALMEIDA, S.A.P. Econômia tropeira paranaense formação de uma memória coletiva: aproveitamento para turismo. Anais eletrônicos: IV Congresso Internacional de História. p.3923-3936, 2009. DOI:10.4025/4cih.pphuem.314 Disponível em Acesso em: 8 de março de 2019. AMANO, T; ONOGI, A; YAMADA, F; KAWAI, M; SHIRAI, K; UEDA, J. Genome-wide association mapping and examination of possible maternal effect for the pace trait of horses. Animal genetics. v.5. p.461-463. 2018. ANDERSSON, L.S.; LARHAMMAR, M.; MEMIC, F.; WOOTZ, H.; SCHWOCHOW, D.; RUBIN, C. J.; PATRA, K.; ARNASON, T.; WELLBRING, L.; HJÄLM, G.; IMSLAND, F. Mutations in DMRT3 affect locomotion in horses and spinal circuit function in mice. Nature, v.488, n.7413, p.642. 2012. ANTIKAS, T.G. The honor to be buried with horses from Mycenaean Nemea to Macedonian Vergina. In Les équidés dans le monde méditerranéen antique: Actes du colloque organisé par l'école française d'Athènes, le centre Camille Jullian et l'UMR 5140 du CNRS, Athènes, 26-28 pp. 143-152. 2005. ASSOCIAÇÃO BRASILEIRA DOS CRIADORES DE JUMENTO PÊGA. Estatutos e Regulamentos. Disponível em < https://abcjpega.org.br/estatuto-e-regulamentos/> Acesso em: 8 de fevereiro de 2019. Associação Brasileira dos Criadores do Cavalo Mangalarga Marchador (ABCCMM). Padrão da Raça. Disponível em Acesso em: 11/03/2019 BORGES, L.A. Mulas em movimento. O mercado interno brasileiro e o negócio de tropas, primeira metade do século XIX. Anos 90, v.23, n.44, p.207-230, 2016. 28 CARNEIRO, G. F., CAVALCANTE LUCENA, J. E., & DE OLIVEIRA BARROS, L. The Current Situation and Trend of the Donkey Industry in South America. Journal of Equine Veterinary Science, v.65, p.106–110, 2018. CENTRO DE ESTUDOS AVAÇADOS EM ECONOMIA APLICADA. Perspectivas para o Agronegócio em 2015. CEPEA. Piracicaba, dezembro/2014. Disponível em: Acesso em: 29/09/2015 COSTA,M.D.;BERGMANN,J.A.G.;RESENDE,A.S.C.;FONSECA,C.G.;FARIA,F.J .C. Estudo da subdivisão genética da raça Mangalarga Marchador. Arq. Bras. Med. Vet. Zootec., v.57, n.2, p.272-280. 2005. ELLIS JUNIOR, A. A economia paulista no século XVIII. Ed. Academia Paulista de Letras:São Paulo, 1979. FONSECA, M.G. Mangalarga Marchador: estudo morfométrico, cinemático e genético da marcha batida e picada. Tese de Doutorado em Clínica Médica Veterinária. UNESP. Jaboticabal, São Paulo, Brasil. 2018. FONSECA, M.G.; DE CAMARGO FERRAZ, G.; LAGE, J.; PEREIRA, G.L.; CURI RA. A genome-wide association study reveals differences in the genetic mechanism of control of the two gait patterns of the Brazilian Mangalarga Marchador breed. Journal of Equine Veterinary Science, v. 53, p. 64-67. 2017. GLOBO, Programa Nosso Campo, TV TEM. Mulas de elite são valiosas e movimentam pecuária no interior de São Paulo. Publicado dia 04/03/2018 07h43. Disponível em Acesso em 10/03/2019. GRUBER, T.; CARVALHO, A.I.; MARTINS I.C. entre mio-mios e embiras:homens e animais no caminho das tropas. Ateliê de História UEPG, V.4, N.1, P. 21-43, 2016. HAN, H; ZENG, L; DANG, R; LAN, X; CHEN, H; LEI, C. The DMRT 3 gene mutation in C hinese horse breeds. Animal genetics. v.46, n.3, p.341-342. 2015. INSTITUTO BRASILEIRO DE GEOGRAFIA E ESTATÍSTICA. Produção da Pecuária Municipal. Rio de Janeiro, V.40, p1-71, 2012. Disponível em: 29 Acesso em: 16/03/2019 JÄDERKVIST, K.; ANDERSSON, L.S.; JOHANSSON, A.M.; ÁRNASON, T.; MIKKO, S.; ERIKSSON, S.; LINDGREN, G. The DMRT3 ‘Gait keeper ’mutation affects performance of Nordic and Standardbred trotters. Journal of animal science, v.92, n.10, p.4279-4286. 2014. KRISTJANSSON, T; BJORNSDOTTIR, S; SIGURDSSON, A; ANDERSSON, L.S; LINDGREN, G; HELYAR, S.J; KLONOWSKI, A.M; ARNASON, T. The effect of the ‘Gait keeper’mutation in the DMRT3 gene on gaiting ability in Icelandic horses. Journal of Animal Breeding and Genetics. v.6, p.415-425. 2014. MANSO, F.; COTHRAN, E.G.; JURAS, R.; GOMES, F.; DA SILVA, N.M.; DA SILVA, G.B.; FERREIRA, L.M.; ABREU, J.M.; MANSO, H.D. DMRT3 mutant allele in batida and picada gaited horses from Campolina and Mangalarga Marchador breeds. Ciência Veterinária nos Trópicos, v.18, n.1, p.58-64. 2015. MARIANTE, A.S.; CAVALCANTE N. Animais do descobrimento: raças domésticas da história do Brasil. Brasília: Embrapa Sede/ Embrapa Recursos Genéticos e Biotecnologia. 2006. 274 p. NICODEMUS, M.C; CLAYTON, H.M. Temporal variables of four-beat, stepping gaits of gaited horses. Applied Animal Behaviour Science. v.80, n.2, p.133-42, 2003. OLIVEIRA, V.B. Uma visão técnica e pedagógica sobre os muares. Tese de Mestrado em Ciências de Educação Agrícola. UFRRJ. Seropédica, Rio de Janeiro, Brasil. 2004. PATTERSON, L.; STAIGER, E.A.; BROOKS, A. DMRT 3 is associated with gait type in Mangalarga Marchador horses, but does not control gait ability. Animal Genetics, v.46, n.2, p.213-215. 2015. PEREIRA, G.L.; MATTEIS, R.; REGITANO, L.C.; CHARDULO, L.A.; CURI, R.A. MSTN, CKM, and DMRT3 gene variants in different lines of quarter horses. Journal of Equine Veterinary Science, v.39, p.33-37. 2016. PROMEROVÁ, M.; ANDERSSON, L.S.; JURAS, R.; PENEDO, M.C.; REISSMANN, M.; TOZAKI, T.; BELLONE, R.; DUNNER, S.; HOŘÍN, P.; IMSLAND, F.; Mikko, S.; Modrý, D.; Roed, K.H.; Schwochow, D.; Vega-Pla, J.L.; 30 Mehrabani-Yeganeh, H.; Yousefi-Mashouf, N.; G Cothran, E.; Lindgren, G.; Andersson, L. Worldwide frequency distribution of the ‘G ait keeper’mutation in the DMRT 3 gene. Animal Genetics, v.45, n.2, p.274-282. 2014. RIBEIRO, P.; COIMBRA, R.; ROCHA, E.; GONÇALVES, G.; ALVES, G.; EUSTÁQUIO, V.; CASTRO, L. Principais diferenças fenotípicas e genéticas entre bardotos e muares. Sinapse Múltipla, v.6, n.2, p.301-305, 2017. RICARD, A.; Does heterozygosity at the DMRT3 gene make French trotters better racers? Genetics Selection Evolution, v.47, n.1, p.10. 2015. ROSSEL, S.; MARSHAL, F.; PETERS, J.; PILGRAM, T.; ADAMS, M.D.; O´CONNOR, D. Domestication of the donkey: Timing, processes, and indicators. Proceedings of the National Academy of Sciences, v.105, n.10, p. 3715–3720, 2008. SUPRINYAK, C.E. Tropas conduzidas pela Barreira de Itapetininga e o comportamento do mercado de muares 1854-1869.História econômica & história de empresas IX, v.2, p. 49-72. 2006. TORRES, A.P.; JARDIM, W.R. Criação do cavalo e de outros equinos. 3ª edição. São Paulo: Nobel. 1992. 654p. 31 CAPÍTULO 2 32 DMRT3 allele frequencies in batida- and picada-gaited donkeys and mules in Brazil Mariana Herman1, Amanda Manara Caceres1, Ana Luísa Holanda de Albuquerque1, Raíssa Oliveira Leite1, César Erineudo Tavares de Araújo2, Diego José Zanzarini Delfiol3, Rogério Abdallah Curi1, Alexandre Secorun Borges1, José Paes de Oliveira-Filho1* 1São Paulo State University (UNESP), School of Veterinary Medicine and Animal Science, Botucatu, Brazil 2Centro Universitário Doutor Leão Sampaio (Unileão), Juazeiro do Norte, Brazil. 3Federal University of Uberlandia, Brazil. * Correspondence: José Paes de Oliveira-Filho jose.oliveira-filho@unesp.br Keywords: Equids, gait, genotyping, PCR-RFLP, Brazil. ABSTRACT: The DMRT3:g.22999655C>A SNP influences the gait types of horses, and the reference-C and non-reference-A alleles have been associated with batida and picada gaits, respectively. Donkeys and mules also have batida or picada gaits, and this study aimed to determine the allele frequency of this SNP in gaited donkeys and mules and to verify whether the genotype influences the type of gait. Thus, 159-mules and 203-donkeys were genotyped. Among the 159 mules assessed, 47% had a CC genotype, and 53% had a CA genotype. The CC genotype was predominant in the donkeys (97%). The AA genotype was not found in the mules or donkeys. The CC and CA genotypes were similarly distributed in the mule group with batida or picada gaits. The frequencies of the CC genotype in the donkeys were similar, regardless of whether the gait was batida or picada. However, the CA genotype was more frequent in donkeys with a picada gait than in those with a batida gait. The previous description of the three genotypes in Mangalarga and Campolina horses, which are the main breeds involved in the production of marching mules in Brazil, explains the higher percentage of CA mules and the very low presence of the mutated allele in donkeys, allowing us to speculate that the mutated allele was inherited from the mares used in the crosses with donkeys. In addition, these results suggest that the gait is not influenced by the aforementioned mutation and that other genes and polymorphisms may influence the trait in equids. Number of words: 3036 words (excluding abstract, section files, figure and table captions, funding statement, acknowledgements, and references in the bibliography) Number of figures: 1 figure Number of tables: 2 tables INTRODUCTION DMRT3 (doublesex and mab-3 related transcription factor 3) is one of the main genes involved in vertebrate coordination of the front and hind limbs and control of stride length during locomotion. A nonsense mutation/polymorphism (g.22999655C>A, EquCab2.0) in the DMRT3 gene, which is responsible for the stop codon (DMRT3_Ser301STOP) and which results in the production of a truncated protein that mailto:jose.oliveira-filho@unesp.br 33 is 174 amino acids shorter than the wild-type protein, had an important effect on domestic horse diversification by determining the gait phenotypes in different horse breeds (1). Regarding worldwide frequency distribution, this variant has been identified in 68 of the 141 genotyped horse breeds, with the highest frequency of polymorphism observed in breeds of horses either classified as gaited or as bred for harness racing (2). Compared with the CA genotype, the AA genotype reinforces the coordination of ipsilateral legs, with a subsequent negative effect on the synchronized movement of contralaterally diagonal legs (3). Several studies have associated the presence of two mutated alleles (AA) with gaited horses (2-6). The AA genotype also has a negative effect on characteristics associated with running (7, 8). Two gait types, batida or picada, have been established by the Mangalarga Marchador horses (MM) and the Pêga Donkey Breeders' associations (9). In the batida gait, the horse’s contralaterally diagonal hooves touch the ground in coupled steps more frequently than occurs with the lateral pairs of hooves, although moments of triple-limb support exist; in contrast, in the picada gait, the steps are more often laterally coupled, rather than being coupled in a contralaterally diagonal manner, and all without loss of triple support moments (10). Studies carried out on the Brazilian MM revealed a predominance of C and A alleles in horses that presented batida or picada gaits, respectively (10-12). In Brazil, the production of gaited mules, which are obtained mainly from the crossing of gaited donkeys of the Pêga and Brasileira breeds with horses of the MM and Campolina breeds (13), has been a prominent activity in agribusiness, primarily for the commercial value of these animals that increasingly gain esteem in gait and morphological-functional sports contests. Since the gait of donkeys and mules can also be classified as batida or picada and consequently may be associated with the DMRT3 nonsense variant, this study aims to determine the allele frequencies of the DMRT3 SNP in gaited donkeys and mules and to verify whether the genotype influences the type of gait—batida or picada—in these animals. MATERIALS AND METHODS Ethical approval statement This study was approved on May 26, 2020 by the Institutional Animal Care and Use Committee (64/2020—CEUA—UNESP). Sample collection The sample size was calculated using OpenEpi software (version 3.0.1) and based on the number of donkeys (30,020) and mules (10,010) registered in the Associação Brasileira dos Criadores de Jumento Pêga (ABCJPÊGA), an estimated prevalence of DMRT3 SNP of 5%, and a 5% margin of error. The results were a minimal sample size of 126 donkeys and 113 mules with and a 99% confidence interval. However, a total of 203 Pêga male donkeys (Equus asinus) and 159 female mules were assessed in this study. Samples were obtained from 38 farms in the Southeast and Midwest regions of Brazil. The sampling was performed under a strict confidentiality agreement to ensure the anonymity of establishments, owners and animals. The researchers tried to collect as many samples as possible according to the availability of the owners during the visits to the farms. All animals were classified by gait type, picada or batida, by an experienced technician and according to the ABCJPÊGA's rules. Genomic DNA was purified from hair bulbs (from the mane or tail) or blood samples and was stored at -80 °C until molecular processing. 34 Sequencing of the donkey DMRT3 gene We aimed to sequence the genomic DNA region corresponding to the mRNA of the donkey DMRT3 gene. To sequence the two exons from the donkey DMRT3 gene, DNA samples from 20 Pêga male donkeys (10 with batida and 10 with picada gaits) were used. To include greater genome diversity in the analysis, the selected animals were unrelated to each other. A polymerase chain reaction (PCR) was performed using specific primers designed to amplify the complete coding DMRT3 sequence (two exons) and the 5′ and 3′ intron–exon junctions (Supplementary Table 1). PCR (25 μL) contained 2.5 μL (200 ng) of template DNA, 0.4 μM of each primer, 12.5 μL of PCR Master Mix (Promega, CA, USA), and 8.5 μL of nuclease-free water. The amplification conditions were as follows: initial denaturation at 95 °C for 5 min, followed by 40 cycles of denaturation at 95 °C for 45 s, then annealing at 59-64 °C for 60 s and extension at 72 °C for 60 s, with a final extension at 72 °C for 5 min. The PCR products were purified and subjected to Sanger sequencing. The obtained sequences and the electropherograms were examined using Geneious® software (Biomatters©, Auckland, New Zealand) and were compared with the Equus caballus (horse) DMRT3 coding sequence (GenBankTM NC_009166.3:22378399-22378896) and the Equus asinus DMRT3 coding predicted sequence (XM_044756984.1). DMRT3 genotyping using PCR-RFLP analysis In this study, the DMRT3:g.22999655C>A SNP was genotyped in donkey and mules DNA samples using the polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) method. Initially, DNA samples from MM horses were genotyped for the nonsense variant DMRT3 by Sanger sequencing to identify the animals of the different genotypes (CC, CA, and AA). The control samples for each genotype were used for the standardized PCR-RFLP method. The DNA was purified from blood or hair bulb samples collected from mules and donkeys and stored at -20 °C. The PCR (25 μL) was performed with 2.5 μL (200 ng) of template DNA, 0.4 μM of each DMRT3_LBMCV_DdeI set primer, 12.5 μL of PCR Master Mix (Promega, CA, USA), and 8.5 μL of nuclease-free water. The amplification conditions were as follows: initial denaturation at 95 °C for 5 min, followed by 40 cycles of denaturation at 95 °C for 45 s, then annealing at 60 °C for 60 s and extension at 72 °C for 60 s, with a final extension at 72 °C for 5 min. Immediately afterward, for rapid detection of the DMRT3_g.22999655C>A SNP, the PCR products were cleaved using DdeI restriction enzymes (Promega, CA, USA). The RFLP reaction mixtures contained 7.3 μL of nuclease-free water, 10 μL of PCR product, 0.2 μL of bovine serum albumin, 2 μL of 10X reaction buffer, and 5u of DdeI enzyme. Reactions were carried out at 37 °C for 30 min. The PCR amplicons and the products of restriction enzyme cleavage were analyzed by 2% agarose gel electrophoresis stained with GelRed® Nucleic Acid Stain (Millipore®, Darmstadt, German). Sanger sequencing was performed for the DMRT3 SNP to validate the PCR-RFLP results using PCR products before being cleaved. Data analysis The allele frequency and standard error for each group were estimated using the following equations: and𝑎𝑙𝑙𝑒𝑙𝑒 𝑓𝑟𝑒𝑞𝑢𝑒𝑛𝑐𝑦 = 𝑡𝑜𝑡𝑎𝑙 𝑛𝑢𝑚𝑏𝑒𝑟 𝑜𝑓 𝑚𝑢𝑡𝑎𝑛𝑡 𝑎𝑙𝑙𝑒𝑙𝑒𝑠 /𝑡𝑜𝑡𝑎𝑙 𝑛𝑢𝑚𝑏𝑒𝑟 𝑜𝑓 𝑎𝑛𝑖𝑚𝑎𝑙𝑠 2 . All calculations were𝑠𝑡𝑎𝑛𝑑𝑎𝑟𝑑 𝑒𝑟𝑟𝑜𝑟 = 2 𝑎𝑙𝑙𝑒𝑙𝑒 𝑓𝑟𝑒𝑞𝑢𝑒𝑛𝑐𝑦 * 1− 𝑎𝑙𝑙𝑒𝑙𝑒 𝑓𝑟𝑒𝑞𝑢𝑒𝑛𝑐𝑦( ) 2 * 𝑠𝑎𝑚𝑝𝑙𝑒 𝑠𝑖𝑧𝑒 35 performed using a spreadsheet program as previously described (14). The relationship between genotypes and gait types was analyzed using the chi-square test. Statistical significance was determined by a P ≤ 0.05, and the data analysis was performed using GraphPad Prism 7 software. The chi-square test was also used to test whether alleles were in Hardy-Weinberg equilibrium (HWE) within the donkeys’ group, and the alleles were considered to exhibit disequilibrium if P < 0.05. Limitations of the study The main limitations of the study were the impossibility of genotyping the mares used in the production of the mules evaluated in the study and obtaining a reliable genealogy of these mules. It was not possible to access the genealogy data of the donkeys; therefore, unfortunately, we were not able to calculate the degree of inbreeding of the studied animals. Additionally, the lack of analysis of the DMRT3 gene coding sequence in the mules may be seen as a limitation of this study; however, it was not the objective of the study, since these infertile hybrid animals cannot be used in in breeding programs, and genotyping these animals would therefore not be a useful tool in the design of mating schemes between donkeys and mares. RESULTS The DMRT3 mRNA sequence obtained from the Pêga donkey DNA samples was deposited in GenBankTM (OP068195.1). Of the 1,718 bases sequenced, 38 bases were from the 5’ UTR, 1,425 bases were from the open reading frame (ORF; 460 bases in exon 1 and 965 bases in exon 2), and 255 bases were from the 3’ UTR. This sequence was 99.94% and 99.59% identical to that of the Equus caballus DMRT3 mRNA (NM_001317265.1) and to that of the predicted Equus asinus DMRT3 mRNA (XM_044756984.1), respectively. Six synonymous SNPs were observed in the donkey DMRT3 coding sequence when compared to that of the horse sequence, i.e., c.396 (C or T), p.132ALA; c.627 (C or G), p.209Val; c.966 (A or C), p.322Ser; c.1131 (T or C), p.377Tre; c.1137 (A or G, p.379Ala; and c.1251 (G or A), p.417Ser. One SNP was also observed in exon 1 (A/G) five bases before the start codon in the 5' UTR. Furthermore, the predicted donkey DMRT3 sequence has two synonymous SNPs (c.315T>C, p.105Ala; c.336C>G, p.112Pro) and three deleted bases (c.359_361delCGC) relative to the horse and Pêga donkey DMRT3 coding sequences. The three protein sequences were 100% identical except for the deleted codon, p.Pro120del, in the predicted donkey DMRT3 sequence. In addition, no changes were observed in the intronic region after exon 1 (146 bases) or before exon 2 (150 bases). Since the three genotypes had already been described in MM horses, it was decided to use DNA samples from horses of this breed to standardize the PCR-RFLP method. Using the restriction enzyme DdeI, it was possible use electrophoresis to identify the three genotypes, i.e., wild-type homozygous (CC, 560-bp band), mutant homozygous (AA, 395- and 165-bp bands) and heterozygous animals (CA, 560-, 395- and 165-bp bands). These genotypes were confirmed by Sanger sequencing (Figure 1). Of the 159 mules assessed, 47% (75/159) were homozygous wild-type (CC), and 53% (84/159) were heterozygous (CA) animals. The CC genotype was predominant in the Pêga donkeys (97%, 196/203), while seven (3%, 7/203) donkeys were identified as heterozygous (CA) for the DMRT3 SNP. The A/A genotype was not found in the mules or donkeys of this study (Table 1). Therefore, the C allele was the most frequent allele in the group of mules and donkeys evaluated (0.736 ±0.025, 0.983 ±0.006), while the frequencies of the A allele in the group of mules and donkeys evaluated, regardless of 36 gait, were 0.264 (±0.025) and 0.017 (±0.006), respectively. The allele distribution of the DMRT3 SNP in the donkey group was in HWE equilibrium (P = 0.879). The mules and donkeys were grouped according to their gait type, with the result that 99 mules were classified as having the batida gait and 60 as having the picada gait, while 101 donkeys were classified as having the batida gait and 102 as having the picada gait (Table 2). Assessing the mules according to the type of gait, it was observed that the CC and CA genotypes were similarly distributed in the mule group with the batida gait (P = 0.484) and in the mule group with the picada gait (P = 0.749). When verifying the distribution of the CC and CA genotypes in the donkeys according to their gait phenotypes, it was found that the CC genotype was more predominant than the CA genotype in both the batida gait group (P < 0.001) and the picada gait group (P < 0.001). In addition, the presence of the CC genotype was statistically similar (P = 0.905) regardless of the type of gait, batida (100/196, 51%) or picada (96/196, 49%). However, the CA genotype was statistically more associated (P < 0.001) with donkeys that had the picada gait (6/7, 86%) than with those that had the batida gait (1/7, 14%). DISCUSSION The donkey (GenBankTM OP068195.1) and horse DMRT3 gene sequences are orthologs, given that in the donkey sequence five synonymous SNPs in the coding region (c.627C>G, c.966A>C, c.1131T>C, c.1137A>G and c.1251G> A) were observed; that is, these SNPs reflect no changes from the amino acid sequence previously described in horses (p.209Val, p.322Ser, p.377Tre, p.379Ala, p.417Ser). The Equus caballus sequence (GenBankTM NC_009166.3:22378399-22378896) used in this study for the comparison with the Equus asinus sequence was obtained through automated prediction, and it, therefore, cannot be said that the SNPs observed in the present study do not also occur in horses. The C allele of the synonymous SNP (c.966A>C, p.322Ser) was also observed in the French (Poitu) donkey and in two breeds of Indian donkeys (Spiti and Leh breeds); on the other hand, the Halari donkeys had only the A allele (15). The A allele was observed in heterozygosis in a single donkey (1/30) of the group of Pega donkeys evaluated in the present study. As the DMRT3_chr23:g.22999655C>A SNP was related to the coordination of forelimbs and pelvic limbs during locomotion (1, 4), some authors have standardized the genotyping of horses for the aforementioned polymorphism using different techniques, e.g., TaqMan SNP probe (1, 2, 4), PCR-sequencing (11) and PCR-RFLP (9, 10, 16). As with previous studies (9, 10, 16) that employed the restriction enzyme DdeI, the methods of the present study entailed standardizing the PCR-RFLP in mules using specific sets of primers and the DdeI enzyme. This methodology enabled differentiation of the evaluated genotypes and was validated by Sanger sequencing, demonstrating its utility as an inexpensive and fast test that can be used to evaluate the presence of mutated alleles in mules and donkeys. Members of the Equidae family have different gaits and variations of these gaits (e.g., picada, batida, and the gaits of different gaited horse breeds) (11). Using the ABCJPêga rules, the mules and donkeys of the present study were grouped according to their natural batida or picada gait pattern, which is to say that the interference of the human rider or trainer with the gait was not taken into account, since mules may adapt to the type of gait required by the trained rider. Due to the greater demand for animals with a comfortable gait for traveling long distances and at low speeds, the selection of marching saddle mules has been based on the crossing of marching donkeys of the Pêga and Brasileira breeds with horses, preferably those of the Mangalarga Marchador and Campolina breeds (13). Although the AA genotype, when compared to the CA or CC 37 genotype, provides greater support for ipsilateral limb coordination, with a negative effect on synchronized laterally diagonal movement (3), which would be of benefit to the picada gait type, in the present study we did not observe the presence of mutant homozygous AA mules or donkeys. In addition, the CA genotype was observed at a low prevalence in the group of donkeys (3%, 7/203) evaluated in the present study, especially when compared to the frequency of this genotype in mules (53%, 84/159). Overall, the frequency of allele A in the groups of mules and donkeys, regardless of gait, was 0.264 ± 0.025 and 0.017 ± 0.006, respectively. Several studies have also linked the presence of the AA genotype with gait horses (2-6). However, similarly to the present study, when the presence of DMRT3_chr23:g.22999655C>A was evaluated in a group of donkeys in India (15), only animals homozygous for the reference allele C were found. Although the number of donkeys was small, these authors suggested that this SNP has been equally distributed among the breeds of donkeys in India. In contrast to what was observed in the present study, where the CC and CA genotypes were similarly distributed both in the group of mules with batida gait (P = 0.484) and in the group with picada gait (P = 0.749), Manso-Filho et al. (11) showed only the CC genotype in MM that presented a batida gait, while in animals with a picada gait, the A allele was predominant, with heterozygosity and homozygosity being observed. Others authors (11-12) also observed the predominance of the C and A alleles in the MM that presented batida and picada gaits, respectively. Although the number of mules genotyped in the present study (159) was higher than the number of horses genotyped for the DMRT3_chr23:g.22999655C>A by Manso-Filho et al. (11) (n=105) and Patterson et al. (10) (n=81), it is difficult to rule out this variant being related to gait in mules. Although the predominance of the CC genotype was observed both in the group of donkeys with the batida (P < 0.001) and picada (P < 0.001) gaits, the CA genotype was more frequently observed (P < 0.001) in donkeys with the picada gait (6/7, 86%) than in those with the batida gait (1/7, 14%). Therefore, even considering the exception of the absence of AA donkeys and the low number of CA donkeys, the greater presence of this genotype in the donkeys with the picada gait is in agreement with other studies in MM horses (10-12). The fact that the three genotypes have already been described in Mangalarga and Campolina horses (10-12), the main horse breeds involved in the commercial production of mules in Brazil, in combination with the higher percentage of heterozygous mules and the low frequency of the mutated allele in the donkey population evaluated in this study, allows us to speculate that the mutated allele observed in heterozygosity in the mules in this study was inherited, above all, from the mare used in the cross with the donkeys. In addition, contrary to our expectations, the type of gait, picada or batida, was not influenced by the DMRT3 SNP in the group of mules or donkeys evaluated. In addition, in Mangalarga horses, a study has shown that unlike what happens in picada gait (lateralized), which is influenced by the A allele, batida gait (diagonalized) may be controlled by another group of genes (9). Therefore, future studies can be carried out to investigate genes that might be associated with the gait type in mules and donkeys, such as genes that are associated with differences in metabolic changes in horses with a batida or picada gait after gait exercise (17). DATA AVAILABILITY STATEMENT The original contributions presented in the study are included in the article, and further inquiries can be directed to the corresponding author. AUTHOR CONTRIBUTIONS 38 MH, CETA, and JPO-F contributed to the conception and design of the study. MH, AMC, CETA, DJZD, and JPO-F contributed to the sample collection. AMC, ALHA, ROL, CETA, and JPO-F contributed to sample processing. MH, ASB, RAC and JPO-F contributed to writing the first drafts of the manuscript. JPO-F contributed to directing the project. All authors contributed to the manuscript revision and have read and approved the submitted version. FUNDING This study was funded by the São Paulo Research Foundation (FAPESP, Brazil), Grant Numbers 19/15076-9 and 19/08143-1. REFERENCES 1. Andersson LS, Larhammar M, Memic F, Wootz H, Schwochow D, Rubin CJ, et al. Mutations in DMRT3 affect locomotion in horses and spinal circuit function in mice. Nature. (2012) 488:642-6. doi: 10.1038/nature11399. 2. Promerová M, Andersson LS, Juras R, Penedo MC, Reissmann M, Tozaki T, et al. Worldwide frequency distribution of the ‘Gait keeper’ mutation in the DMRT3 gene. Anim Genet. (2014) 45:274-82. doi: 10.1111/age.12120 3. Kristjansson T, Bjornsdottir S, Sigurdsson A, Andersson LS, Lindgren G, Helyar SJ, et al. The effect of the ‘Gait keeper’mutation in the DMRT3 gene on gaiting ability in Icelandic horses. J Anim Breed Genet. (2014) 6:415-25. doi: 10.1111/jbg.12112. 4. Jäderkvist K, Andersson LS, Johansson AM, Árnason T, Mikko S, Eriksson S, et al. The DMRT3 ‘Gait keeper ’mutation affects performance of Nordic and Standardbred trotters. J Anim Sci. (2014) 92:4279-86. doi: 10.2527/jas.2014-7803. 5. Han H, Zeng L, Dang R, Lan X, Chen H, Lei C. The DMRT3 gene mutation in Chinese horse breeds. Anim Genet. (2015) 46:341-2. doi: 10.1111/age.12292. 6. Novoa-Bravo M, Jäderkvist Fegraeus K, Rhodin M, Strand E, Garcia LF, Lindgren G. Selection on the Colombian paso horse’s gaits has produced kinematic differences partly explained by the DMRT3 gene. PLoS ONE. (2018) 13:e0202584. doi: 10.1371/journal.pone.0202584. 7. Ricard A. Does heterozygosity at the DMRT3 gene make French trotters better racers? Genet Sel Evol. (2015) 47(1):1-16. doi: 10.1186/s12711-015-0095-7. 8. Pereira GL, Matteis R, Regitano LC, Chardulo LA, Curi RA. MSTN, CKM, and DMRT3 gene variants in different lines of quarter horses. J Equine Vet Sci. (2016) 39:33-7. doi: 10.1016/j.jevs.2015.09.001. 9. Fonseca MG, De Camargo Ferraz G, Lage J, Pereira GL, Curi RA. A genome-wide association study reveals differences in the genetic mechanism of control of the two gait patterns of the Brazilian Mangalarga Marchador breed. J Equine Veterinary Science. (2017), v.53, p.64-67. 2017. 10. Patterson L, Staiger EA, Brooks A. DMRT 3 is associated with gait type in Mangalarga Marchador horses, but does not control gait ability. Anim Genet. (2015) 46:213-215. doi: 10.1111/age.12273 11. Manso F, Cothran EG, Juras R, Gomes F, Da Silva NM, Da Silva GB, et al. DMRT3 mutant allele in batida and picada gaited horses from Campolina and Mangalarga Marchador breeds. Cienc. Vet Trop. (2015) 18:58-64. 12. Bussiman FO, Santos BA, Silva BCA, Perez BC, Pereira GL, Chardulo LAL, et al. Allelic and genotypic frequencies of the DMRT3 gene in the Brazilian horse breed 39 Mangalarga Marchador and their association with types of gait. Genet Mol Res. (2019) 18:gmr18217. doi: 10.4238/gmr18217. 13. Torres AP, Jardim WR. (1992). Criação do cavalo e de outros equinos. São Paulo: Nobel. 14. Delfiol DJ, Oliveira-Filho JP, Badial PR, Battazza A, Araujo-Junior JP, Borges AS. Estimation of the allele frequency of type 1 polysaccharide storage myopathy and malignant hyperthermia in Quarter Horses in Brazil. J Equine Vet Sci. (2018) 70:38-41. doi: 10.1016/j.jevs.2018.06.015Andersson LS, Larhammar M, Memic F, Wootz H, Schwochow D, Rubin CJ, et al. Mutations in DMRT3 affect locomotion in horses and spinal circuit function in mice. Nature. (2012) 488:642-6. doi: 10.1038/nature11399. 15. Bhardwaj A, Nayan V, Legha RA, Bhattacharya TK, Pal Y, Giri SK. (2023) Identification and characterization of single nucleotide polymorphisms in DMRT3 gene in Indian horse (Equus caballus) and donkey (Equus asinus) populations. Anim Biotechnol. 1-11. 2023. doi: 10.1080/10495398.2023.2206866. 16. Regatieri IC, Eberth JE, Sarver F, Lear TL, Bailey E. Comparison of DMRT3 genotypes among American Saddlebred horses with reference to gait. Anim Genet. (2016) 47:603-5. doi: 10.1111/age.12458. 17. Bussiman FO, Santos BA, Silva BCA, Mamani GM., Grigoletto L, Pereira GL.; et al. Genome-wide association study: Understanding the genetic basis of the gait type in Brazilian Mangalarga Marchador horses, a preliminary study. Livest Sci. (2020) 231:103867. doi: 10.1016/j.livsci.2019.103867. 40 Figure Captions Figure 1. Partial chromatogram showing capillary sequencing results for wild-type homozygous (A), heterozygous (B) and mutated homozygous (C) EquCab2.0 DMRT3_chr23:g.22999655C>A variant. Wild-type allele (cytosine) and the respective amino acid serine (blue arrow); double peaks (cytosine/guanine) and the related amino acid stop codon or serine (green arrow), mutant allele (adenine) and TAG stop codon (red arrow). Images were obtained using Geneious® 10.0 software (Biomartters Ltd., Auckland, New Zealand). 41 Figure Captions Figure 1. Agarose gel (2%) showing PCR-RFLP results for the DMRT3_chr23:g.22999655C>A variant. Note, Low ladder of 100 bp; CC, homozygous wild-type mule (single band of 560 bp); CA, heterozygous mule (three bands of 560, 395 and 165 bp); AA, homozygous horse (two bands of 395 and 165 bp); NC, negative control (sample without DNA) without visualization of electrophoretic bands. 42 Figure 2. Partial chromatogram showing capillary sequencing results for wild-type homozygous (A), heterozygous (B) and mutated homozygous (C) DMRT3_chr23:g.22999655C>A SNP. Wild-type allele (cytosine) and the respective amino acid serine (blue arrow); double peaks (cytosine/guanine) and the related amino acid stop codon or serine (green arrow), mutant allele (adenine) and TAG stop codon (red arrow). Images were obtained using Geneious® 10.0 software (Biomartters Ltd., Auckland, New Zealand). 43 Table 1: Distribution of genotypes (CC, CA and AA) of the DMRT3_chr23:g.22999655C>A mutation according to the phenotype (batida or picada gait) in 159 mules. Gait Genotypes Batida Picada Total CC 46 (46%) 29 (48%) 75 (47%) CA 53 (54%) 31 (52%) 84 (53%) AA ND* ND* Total 99 60 159 *ND, not detected. Table 2: Distribution of genotypes (CC, CA and AA) of the DMRT3_chr23:g.22999655C>A mutation according to the phenotype (batida or picada gait) in 203 donkeys. Gait Genotypes Batida Picada Total CC 100 (99%) 96 (94%) 196 (97%) CA 1 (1%) 6 (6%) 7 (3%) AA ND ND ND Total 101 102 203 *ND, not detected 44 Supplementary Table 1. PCR primers for the amplification of the DMRT3 gene exons, 5′ and 3′ intron–exon junctions, and 5’ and 3’ UTRs in donkeys (Equus asinus) and for the detection of the DMRT3_chr23:g.22999655C>A variant. Primers Sequences Product (bp¹) Annealing temperature JP_DMRT3_EXON1_8 AAAGACGGGTGCCGCAT GTAGCGCTTGTGACCCTTGA 315 64 °C JP_DMRT3_EXON1_9 GCTTCAAGGACTGCACCT TTCTGCCCGGAAAGAACC 479 62 °C JP_DMRT3_EXON1_1 0 CTGGCTCAAGGGTCACAAG AGGCCAACTTCCGAAACC 457 62 °C JP_DMRT3_EXON2_3 CATTTGCCAGTGACATAGTTTGG CAAGCTGAAGGGCAGAGAAA 454 59 °C JP_DMRT3_EXON2_4 CAGAGACCTTCAGCGACAAA GTCATCCTCGGTGTAAAGAGAC 866 62 °C JP_DMRT3_EXON2_5 GCAGACTCTAGTAACGTTGTCC CCCAGCTTTCCCAAGACTATT 666 62 °C DMRT3_LBMCV_DdeI ACAGAGACCTTCAGCGACAA GGGTTGGGGACAACGTTACT 560 60 °C ¹base pairs 45 Equus asinus DMRT3 mRNA complete cds LOCUS OP068195 1718 bp mRNA linear MAM 26-SEP-2022 DEFINITION Equus asinus doublesex and mab-3 related transcription factor 3 (DMRT3) mRNA, complete cds. ACCESSION OP068195 VERSION OP068195.1 KEYWORDS . SOURCE Equus asinus (ass) ORGANISM Equus asinus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. REFERENCE 1 (bases 1 to 1718) AUTHORS Oliveira-Filho,J.P. TITLE Direct Submission JOURNAL Submitted (23-JUL-2022) Veterinary Clinical Science, Sao Paulo State University (Unesp), School of Veterinary Medicine and Animal Science, Prof. Doutor Walter Mauricio Corre, Botucatu, Sao Paulo 18618681, Brazil COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..1718 /organism="Equus asinus" /mol_type="mRNA" /db_xref="taxon:9793" /chromosome="23" /sex="male" /tissue_type="blood" /country="Brazil" /note="breed: Pega" gene 1..1718 /gene="DMRT3" CDS 39..1463 /gene="DMRT3" /codon_start=1 /product="doublesex and mab-3 related transcription factor 3" /protein_id="UXE46280.1" /translation="MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGH KRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGD AAAAAPQPPPTSQPSQPPPPQRPAAELAAAAALRWATEPQPGALQAQLAKPDLTEERL GDGSSADNTETFSDKDTDQRSSPDVVKSKGCFTPESPEVVSVDEGGYAVQKNGGTSES RPDSPKYHGEQNHLLIEGPSGTVSLPFSLKANRPPLEVLKKIFPNQKPTVLELILKGC GGDLVSAVEVLLSSRSSASAADRTSAEPESLVLPSNGHIFEHTLSSYPISSSKWSVGS AFRVPDTLRFSADSSNVVPNPLAVPLQHPFPQPPRYPLMLRNTLARNQSSPFLPNDVT LWNTMTLQQQYQLRSQYVSPFPGSSPSVFRSSPVLPTRAPEDPRISIPDDGCPIVSKQ SLYTEDDYDERSDSSDSRILNTSS" ORIGIN 1 ccgccgccag cccgccagct cttccgggag ctcrgggcat gaacggctac ggttccccct 61 acctgtacat gggcggcccg gtgtcgcagc cgccgcgggc gcccttgcag cgcacgccca 121 agtgcgcgcg ctgccgcaac cacggggtgc tgtcctggct caagggtcac aagcgctact 181 gccgcttcaa ggactgcacc tgcgagaagt gcatcctcat catcgagcgg cagagggtca 241 tggcggcgca ggtggcgctg cgccggcagc aagctaacga gagcctcgag agcctcattc 301 ccgactcgct gcgtgctctg cccggccccc cgccgccggg ggacgccgcc gctgccgccc 361 cgcagccgcc gcccacctcg cagccgtctc agccgccgcc gccgcagcgt cccgccgccg 421 agttggctgc ggctgccgcg ctgcgctggg ccaccgagcc gcagcccggg gcgctgcagg 481 cgcagctcgc caagccagat ttgactgagg agcgacttgg ggacggcagc tccgcagaca 541 acacagagac cttcagcgac aaagacaccg accagaggag ctccccagat gtggtgaaaa 601 gtaagggctg cttcaccccg gagagccccg aggtcgtgtc tgtggatgaa ggcgggtatg 661 cggtscagaa gaacggaggc acctccgaga gccgccccga cagtcccaag taccacgggg https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=9793 https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=9793 https://www.ncbi.nlm.nih.gov/nuccore/OP068195.1?from=1&to=1718 https://www.ncbi.nlm.nih.gov/nuccore/OP068195.1?from=39&to=1463 https://www.ncbi.nlm.nih.gov/protein/2306691002 46 721 aacagaatca cctcctgatc gagggcccct cggggaccgt ttctctgccc ttcagcttga 781 aagccaacag accgcccctg gaagtgttaa aaaaaatctt ccccaaccag aagcccacgg 841 tgctggagct catcctgaag ggctgtgggg gcgacctggt gagcgccgtg gaggtcctcc 901 tctccagccg ctcctcggcc tcggccgccg accgaacttc ggcagagccc gagagcctcg 961 tgttgccctc caacgggcac atctttgaac acaccttgag ctcmtacccc atctcctctt 1021 ccaaatggtc cgtgggatcg gccttcaggg tcccagacac gttgaggttt tccgcagact 1081 ctagtaacgt tgtccccaac cccttggccg tgcccctgca gcatcctttc ccccagccgc 1141 cccggtaccc tctgatgctg aggaatacyt tggcragaaa ccagtcgagc cccttcctgc 1201 ccaatgatgt caccctgtgg aacaccatga cgctgcagca gcagtaccag ctgaggtccc 1261 agtacgtcag ccctttcccc gggagctcrc ccagcgtctt cagaagctcg cctgtccttc 1321 ccacgcgcgc ccccgaagac cctcggatct ccatccctga cgatgggtgt ccgattgtgt 1381 caaagcagtc tctttacacc gaggatgact atgacgagag gtccgactcc tcagactcta 1441 gaatactcaa cacatcatct taaagtggta ccgggtggct ggtgaccagg tgacattttc 1501 tgtgcatttg aactctgacc ccctgccctc cccaggagag gcctcgtcct gtgtataccc 1561 tttccttctg tttgacaaag tgactgtgct tgattctata ccttagcaat aaaaacataa 1621 cttatttaat ttcttgcact tcactggaaa atgccaaata gctctgctct gcggctttag 1681 tgctgaatgt ttattgtaaa agagagtcta atgctaag // 47 Author guidelines General standards Article type Frontiers requires authors to select the appropriate article type for their manuscript and to comply with the article type descriptions defined in the journal's 'Article types' page, which can be seen from the 'For authors' menu on every Frontiers journal page. Please pay close attention to the word count limits. Templates If working with Word please use our Word templates. If you wish to submit your article as LaTeX, we recommend our LaTeX templates. For LaTeX files, please ensure all relevant manuscript files are uploaded: .tex file, PDF, and .bib file (if the bibliography is not already included in the .tex file). During the interactive review, authors are encouraged to upload versions using track changes. Editors and reviewers can only download the PDF file of the submitted manuscript. Manuscript length Frontiers encourages the authors to closely follow the article word count lengths given in the 'Article types' page of the journals. The manuscript length includes only the main body of the text, footnotes, and all citations within it, and excludes the abstract, section titles, figure and table captions, funding statement, acknowledgments, and references in the bibliography. Please indicate the number of words and the number of figures and tables included in your manuscript on the first page. Language editing Frontiers requires manuscripts submitted to meet international English language standards to be considered for publication. https://www.frontiersin.org/Design/zip/Frontiers_Word_Templates.zip https://www.frontiersin.org/design/zip/Frontiers_LaTeX_Templates.zip https://www.frontiersin.org/about/peer-review 48 For authors who would like their manuscript to receive language editing or proofreading to improve the clarity of the manuscript and help highlight their research, Frontiers recommends the language-editing services provided by the following external partners. Note that sending your manuscript for language editing does not imply or guarantee that it will be accepted for publication by a Frontiers journal. Editorial decisions on the scientific content of a manuscript are independent of whether it has received language editing or proofreading by these partner services or other services. Editage Frontiers is pleased to recommend the language-editing service provided by our external partner Editage to authors who believe their manuscripts would benefit from professional editing. These services may be particularly useful for researchers for whom English is not the primary language. They can help to improve the grammar, syntax, and flow of your manuscript prior to submission. Frontiers authors will receive a 10% discount by visiting the following link: editage.com/frontiers. The Charlesworth Group Frontiers recommends the Charlesworth Group's author services, who has a long-standing track record in language editing and proofreading. This is a third-party service for which Frontiers authors will receive a 10% discount by visiting the following link: www.cwauthors.com/frontiers. Frontiers推荐您使用在英语语言编辑和校对领域具有悠久历史和良好口碑的查尔 斯沃思作者服务。此项服务由第三方为您提供，Frontiers中国作者通过此链接提 交稿件时可获得10％的特别优惠: www.cwauthors.com.cn/frontiers Language style The default language style at Frontiers is American English. If you prefer your article to be formatted in British English, please specify this on the first page of your manuscript. For any questions regarding style, Frontiers recommends authors to consult the Chicago Manual of Style. Search engine optimization (SEO) There are a few simple ways to maximize your article's discoverability. Follow the steps below to improve the search results of your article: ● include a few of your article's keywords in the title of the article ● do not use long article titles https://editage.com/frontiers/ https://www.cwauthors.com/frontiers/ https://www.cwauthors.com.cn/frontiers/ https://www.chicagomanualofstyle.org/home.html 49 ● pick 5-8 keywords using a mix of generic and more specific terms on the article subject(s) ● use the maximum amount of keywords in the first two sentences of the abstract ● use some of the keywords in level 1 headings. CrossMark policy CrossMark is a multi-publisher initiative to provide a standard way for readers to locate the current version of a piece of content. By applying the CrossMark logo Frontiers is committed to maintaining the content it publishes and to alerting readers to changes if and when they occur. Clicking on the CrossMark logo will tell you the current status of a document and may also give you additional publication record information about the document. Title The title should be concise, omitting terms that are implicit and, where possible, be a statement of the main result or conclusion presented in the manuscript. Abbreviations should be avoided within the title. Witty or creative titles are welcome, but only if relevant and within measure. Consider if a title meant to be thought-provoking might be misinterpreted as offensive or alarming. In extreme cases, the editorial office may veto a title and propose an alternative. Authors should avoid: ● titles that are a mere question without giving the answer ● unambitious titles, for example starting with 'Towards,' 'A description of,' 'A characterization of' or 'Preliminary study on' ● vague titles, for example starting with 'Role of', 'Link between', or 'Effect of' that do not specify the role, link, or effect ● including terms that are out of place, for example the taxonomic affiliation apart from species name. For Corrigenda, General Commentaries, and Editorials, the title of your manuscript should have the following format: ● 'Corrigendum: Title of Original Article' ● General Commentaries: 'Commentary: Title of Original Article' 'Response: Commentary: Title of Original Article' ● 'Editorial: Title of Research Topic' The running title should be a maximum of five words in length. https://www.crossref.org/crossmark/index.html 50 Authors and affiliations All names are listed together and separated by commas. Provide exact and correct author names as these will be indexed in official archives. Affiliations should be keyed to the author's name with superscript numbers and be listed as follows: ● Laboratory, Institute, Department, Organization, City, State abbreviation (only for United States, Canada, and Australia), and Country (without detailed address information such as city zip codes or street names). Example: Max Maximus1 1 Department of Excellence, International University of Science, New York, NY, United States. Correspondence The corresponding author(s) should be marked with an asterisk in the author list. Provide the exact contact email address of the corresponding author(s) in a separate section. Example: Max Maximus* maximus@iuscience.edu If any authors wish to include a change of address, list the present address(es) below the correspondence details using a unique superscript symbol keyed to the author(s) in the author list. Equal contributions The authors who have contributed equally should be marked with a symbol (†) in the author list of the doc/latex and pdf files of the manuscript uploaded at submission. Please use the appropriate standard statement(s) to indicate equal contributions: ● Equal contribution: These authors contributed equally to this work ● First authorship: These authors share first authorship ● Senior authorship: These authors share senior authorship ● Last authorship: These authors share last authorship ● Equal contribution and first authorship: These authors contributed equally to this work and share first authorship ● Equal contribution and senior authorship: These authors contributed equally to this work and share senior authorship ● Equal contribution and last authorship: These authors contributed equally to this work and share last authorship Example: Max Maximus 1†, John Smith2† and Barbara Smith1 †These authors contributed equally to this work and share first authorship 51 Consortium/group and collaborative authors Consortium/group authorship should be listed in the manuscript with the other author(s). In cases where authorship is retained by the consortium/group, the consortium/group should be listed as an author separated by a comma or 'and'. The consortium/group name will appear in the author list, in the citation, and in the copyright. If provided, the consortium/group members will be listed in a separate section at the end of the article. For the collaborators of the consortium/group to be indexed in PubMed, they do not have to be inserted in the Frontiers submission system individually. However, in the manuscript itself, provide a section with the name of the consortium/group as the heading followed by the list of collaborators, so they can be tagged accordingly and indexed properly. Example: John Smith, Barbara Smith and The Collaborative Working Group. In cases where work is presented by the author(s) on behalf of a consortium/group, it should be included in the author list separated with the wording 'for' or 'on behalf of.' The consortium/group will not retain authorship and will only appear in the author list. Example: John Smith and Barbara Smith on behalf of The Collaborative Working Group. Abstract As a primary goal, the abstract should make the general significance and conceptual advance of the work clearly accessible to a broad readership. The abstract should be no longer than a single paragraph and should be structured, for example, according to the IMRAD format. For the specific structure of the abstract, authors should follow the requirements of the article type or journal to which they're submitting. Minimize the use of abbreviations and do not cite references, figures or tables. For clinical trial articles, please include the unique identifier and the URL of the publicly-accessible website on which the trial is registered. Keywords All article types require a minimum of five and a maximum of eight keywords. 52 Text The entire document should be single-spaced and must contain page and line numbers in order to facilitate the review process. The manuscript should be written using either Word or LaTeX. See above for templates. Nomenclature The use of abbreviations should be kept to a minimum. Non-standard abbreviations should be avoided unless they appear at least four times, and must be defined upon first use in the main text. Consider also giving a list of non-standard abbreviations at the end, immediately before the acknowledgments. Equations should be inserted in editable format from the equation editor. Italicize gene symbols and use the approved gene nomenclature where it is available. For human genes, please refer to the HUGO Gene Nomenclature Committee (HGNC). New symbols for human genes should be submitted to the HGNC here. Common alternative gene aliases may also be reported, but should not be used alone in place of the HGNC symbol. Nomenclature committees for other species are listed here. Protein products are not italicized. We encourage the use of Standard International Units in all manuscripts. Chemical compounds and biomolecules should be referred to using systematic nomenclature, preferably using the recommendations by the International Union of Pure and Applied Chemistry (IUPAC). Astronomical objects should be referred to using the nomenclature given by the International Astronomical Union (IAU) provided here. Life Science Identifiers (LSIDs) for ZOOBANK registered names or nomenclatural acts should be listed in the manuscript before the keywords. An LSID is represented as a uniform resource name (URN) with the following format: urn:lsid::<