Logo do repositório

Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom

dc.contributor.authorAndriao-Escarso, S. H.
dc.contributor.authorSoares, A. M.
dc.contributor.authorFontes, MRM
dc.contributor.authorFuly, A. L.
dc.contributor.authorCorrea, FMA
dc.contributor.authorRosa, J. C.
dc.contributor.authorGreene, L. J.
dc.contributor.authorGiglio, JR
dc.contributor.institutionUniversidade de São Paulo (USP)
dc.contributor.institutionUniv Ribeirao Preto
dc.contributor.institutionUniversidade Estadual Paulista (Unesp)
dc.contributor.institutionUniversidade Federal do Rio de Janeiro (UFRJ)
dc.date.accessioned2014-05-20T13:49:22Z
dc.date.available2014-05-20T13:49:22Z
dc.date.issued2002-08-15
dc.description.abstractAn acidic (pI similar to 4.5) phospholipase A(2) (BthA-I-PLA(2)) was isolated from Bothrops jararacussu snake venom by ion-exchange chromatography on a CM-Sepharose column followed by reverse phase chromatography on an RP-HPLC C-18 column. It is an similar to13.7 kDa single chain Asp49 PLA(2) with approximately 122 amino acid residues, 7 disulfide bridges, and the following N-terminal sequence: 'SLWQFGKMINYVMJGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCC(51). Crystals of this acidic protein diffracted beyond 2.0 Angstrom resolution. These crystals are monoclinic and have unit cell dimensions of a = 33.9, b = 63.8, c = 49.1 Angstrom, and beta = 104.0degrees. Although not myotoxic, cytotoxic, or lethal, the protein was catalytically 3-4 tithes more active than BthTX-II, a basic D49 myotoxic PLA(2) from the same venom and other Bothrops venoms. Although it showed no toxic activity, it was able to induce time-independent edema, this activity being inhibited by EDTA. In addition, BthA-I-PLA(2) caused a hypotensive response in the rat and inhibited platelet aggregation, Catalytic, antiplatelet and other activities were abolished by chemical modification with 4-bromophenacyl bromide, which is known to covalently bind to His48 of the catalytic site. Antibodies raised against crude B. jararacussu venom recognized this acidic PLA(2), while anti-Asp49-BthTX-II recognized it weakly and anti-Lys49-BthTX-I showed the least cross-reaction. These data confirm that myotoxicity does not necessarily correlate with catalytic activity in native PLA(2) homologues and that either of these two activities may exist alone. BthA-I-PLA(2), in addition to representing a relevant molecular model of catalytic activity, is also a promising hypotensive agent and platelet aggregation inhibitor for further studies. (C) 2002 Elsevier B.V. All rights reserved.en
dc.description.affiliationUniv São Paulo, Dept Bioquim & Imunol, FMRP, BR-14049900 Ribeirao Preto, SP, Brazil
dc.description.affiliationUniv Ribeirao Preto, Dept Biotecnol, Ribeirao Preto, SP, Brazil
dc.description.affiliationUniv Estadual Paulista, Dept Fis & Biofis, IB, Botucatu, SP, Brazil
dc.description.affiliationFed Univ Rio de Janeiro, Dept Bioquim & Med, Ctr Ciências Saude, BR-21941 Rio de Janeiro, Brazil
dc.description.affiliationUniv São Paulo, Dept Farmacol, FMRP, BR-14049900 Ribeirao Preto, SP, Brazil
dc.description.affiliationUniv São Paulo, Ctr Quim Prot, BR-14049900 Ribeirao Preto, SP, Brazil
dc.description.affiliationUniv São Paulo, Dept Biol Celular Mol & Bioagentes Patogenicos, BR-14049900 Ribeirao Preto, SP, Brazil
dc.description.affiliationUnespUniv Estadual Paulista, Dept Fis & Biofis, IB, Botucatu, SP, Brazil
dc.format.extent723-732
dc.identifierhttp://dx.doi.org/10.1016/S0006-2952(02)01210-8
dc.identifier.citationBiochemical Pharmacology. Oxford: Pergamon-Elsevier B.V., v. 64, n. 4, p. 723-732, 2002.
dc.identifier.doi10.1016/S0006-2952(02)01210-8
dc.identifier.issn0006-2952
dc.identifier.urihttp://hdl.handle.net/11449/17595
dc.identifier.wosWOS:000177778000018
dc.language.isoeng
dc.publisherElsevier B.V.
dc.relation.ispartofBiochemical Pharmacology
dc.relation.ispartofjcr4.235
dc.relation.ispartofsjr1,832
dc.rights.accessRightsAcesso restritopt
dc.sourceWeb of Science
dc.subjectBothrops jararacussupt
dc.subjectacidic phospholipase A(2)pt
dc.subjectN-terminal sequencept
dc.subjectX-ray crystallographypt
dc.subjectplatelet aggregation inhibitionpt
dc.subjecthypotensive effectpt
dc.titleStructural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venomen
dc.typeArtigopt
dcterms.licensehttp://www.elsevier.com/about/open-access/open-access-policies/article-posting-policy
dcterms.rightsHolderElsevier B.V.
dspace.entity.typePublication
relation.isOrgUnitOfPublicationab63624f-c491-4ac7-bd2c-767f17ac838d
relation.isOrgUnitOfPublication.latestForDiscoveryab63624f-c491-4ac7-bd2c-767f17ac838d
unesp.author.orcid0000-0003-0144-9726[7]
unesp.author.orcid0000-0002-4634-6221[3]
unesp.author.orcid0000-0003-4067-9524[5]
unesp.campusUniversidade Estadual Paulista (UNESP), Instituto de Biociências, Botucatupt
unesp.departmentFísica e Biofísica - IBBpt

Arquivos