Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom
| dc.contributor.author | Andriao-Escarso, S. H. | |
| dc.contributor.author | Soares, A. M. | |
| dc.contributor.author | Fontes, MRM | |
| dc.contributor.author | Fuly, A. L. | |
| dc.contributor.author | Correa, FMA | |
| dc.contributor.author | Rosa, J. C. | |
| dc.contributor.author | Greene, L. J. | |
| dc.contributor.author | Giglio, JR | |
| dc.contributor.institution | Universidade de São Paulo (USP) | |
| dc.contributor.institution | Univ Ribeirao Preto | |
| dc.contributor.institution | Universidade Estadual Paulista (Unesp) | |
| dc.contributor.institution | Universidade Federal do Rio de Janeiro (UFRJ) | |
| dc.date.accessioned | 2014-05-20T13:49:22Z | |
| dc.date.available | 2014-05-20T13:49:22Z | |
| dc.date.issued | 2002-08-15 | |
| dc.description.abstract | An acidic (pI similar to 4.5) phospholipase A(2) (BthA-I-PLA(2)) was isolated from Bothrops jararacussu snake venom by ion-exchange chromatography on a CM-Sepharose column followed by reverse phase chromatography on an RP-HPLC C-18 column. It is an similar to13.7 kDa single chain Asp49 PLA(2) with approximately 122 amino acid residues, 7 disulfide bridges, and the following N-terminal sequence: 'SLWQFGKMINYVMJGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCC(51). Crystals of this acidic protein diffracted beyond 2.0 Angstrom resolution. These crystals are monoclinic and have unit cell dimensions of a = 33.9, b = 63.8, c = 49.1 Angstrom, and beta = 104.0degrees. Although not myotoxic, cytotoxic, or lethal, the protein was catalytically 3-4 tithes more active than BthTX-II, a basic D49 myotoxic PLA(2) from the same venom and other Bothrops venoms. Although it showed no toxic activity, it was able to induce time-independent edema, this activity being inhibited by EDTA. In addition, BthA-I-PLA(2) caused a hypotensive response in the rat and inhibited platelet aggregation, Catalytic, antiplatelet and other activities were abolished by chemical modification with 4-bromophenacyl bromide, which is known to covalently bind to His48 of the catalytic site. Antibodies raised against crude B. jararacussu venom recognized this acidic PLA(2), while anti-Asp49-BthTX-II recognized it weakly and anti-Lys49-BthTX-I showed the least cross-reaction. These data confirm that myotoxicity does not necessarily correlate with catalytic activity in native PLA(2) homologues and that either of these two activities may exist alone. BthA-I-PLA(2), in addition to representing a relevant molecular model of catalytic activity, is also a promising hypotensive agent and platelet aggregation inhibitor for further studies. (C) 2002 Elsevier B.V. All rights reserved. | en |
| dc.description.affiliation | Univ São Paulo, Dept Bioquim & Imunol, FMRP, BR-14049900 Ribeirao Preto, SP, Brazil | |
| dc.description.affiliation | Univ Ribeirao Preto, Dept Biotecnol, Ribeirao Preto, SP, Brazil | |
| dc.description.affiliation | Univ Estadual Paulista, Dept Fis & Biofis, IB, Botucatu, SP, Brazil | |
| dc.description.affiliation | Fed Univ Rio de Janeiro, Dept Bioquim & Med, Ctr Ciências Saude, BR-21941 Rio de Janeiro, Brazil | |
| dc.description.affiliation | Univ São Paulo, Dept Farmacol, FMRP, BR-14049900 Ribeirao Preto, SP, Brazil | |
| dc.description.affiliation | Univ São Paulo, Ctr Quim Prot, BR-14049900 Ribeirao Preto, SP, Brazil | |
| dc.description.affiliation | Univ São Paulo, Dept Biol Celular Mol & Bioagentes Patogenicos, BR-14049900 Ribeirao Preto, SP, Brazil | |
| dc.description.affiliationUnesp | Univ Estadual Paulista, Dept Fis & Biofis, IB, Botucatu, SP, Brazil | |
| dc.format.extent | 723-732 | |
| dc.identifier | http://dx.doi.org/10.1016/S0006-2952(02)01210-8 | |
| dc.identifier.citation | Biochemical Pharmacology. Oxford: Pergamon-Elsevier B.V., v. 64, n. 4, p. 723-732, 2002. | |
| dc.identifier.doi | 10.1016/S0006-2952(02)01210-8 | |
| dc.identifier.issn | 0006-2952 | |
| dc.identifier.uri | http://hdl.handle.net/11449/17595 | |
| dc.identifier.wos | WOS:000177778000018 | |
| dc.language.iso | eng | |
| dc.publisher | Elsevier B.V. | |
| dc.relation.ispartof | Biochemical Pharmacology | |
| dc.relation.ispartofjcr | 4.235 | |
| dc.relation.ispartofsjr | 1,832 | |
| dc.rights.accessRights | Acesso restrito | pt |
| dc.source | Web of Science | |
| dc.subject | Bothrops jararacussu | pt |
| dc.subject | acidic phospholipase A(2) | pt |
| dc.subject | N-terminal sequence | pt |
| dc.subject | X-ray crystallography | pt |
| dc.subject | platelet aggregation inhibition | pt |
| dc.subject | hypotensive effect | pt |
| dc.title | Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom | en |
| dc.type | Artigo | pt |
| dcterms.license | http://www.elsevier.com/about/open-access/open-access-policies/article-posting-policy | |
| dcterms.rightsHolder | Elsevier B.V. | |
| dspace.entity.type | Publication | |
| relation.isOrgUnitOfPublication | ab63624f-c491-4ac7-bd2c-767f17ac838d | |
| relation.isOrgUnitOfPublication.latestForDiscovery | ab63624f-c491-4ac7-bd2c-767f17ac838d | |
| unesp.author.orcid | 0000-0003-0144-9726[7] | |
| unesp.author.orcid | 0000-0002-4634-6221[3] | |
| unesp.author.orcid | 0000-0003-4067-9524[5] | |
| unesp.campus | Universidade Estadual Paulista (UNESP), Instituto de Biociências, Botucatu | pt |
| unesp.department | Física e Biofísica - IBB | pt |
Arquivos
Licença do pacote
1 - 1 de 1
Carregando...
- Nome:
- license.txt
- Tamanho:
- 1.71 KB
- Formato:
- Item-specific license agreed upon to submission
- Descrição:

