Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom
| dc.contributor.author | Da Silva, S. L. | |
| dc.contributor.author | Dias-Junior, C. A. [UNESP] | |
| dc.contributor.author | Baldasso, P. A. | |
| dc.contributor.author | Damico, D. C. S. | |
| dc.contributor.author | Carvalho, B. M. A. | |
| dc.contributor.author | Garanto, A. | |
| dc.contributor.author | Acosta, G. | |
| dc.contributor.author | Oliveira, E. | |
| dc.contributor.author | Albericio, F. | |
| dc.contributor.author | Soares, A. M. | |
| dc.contributor.author | Marangoni, S. | |
| dc.contributor.author | Resende, R. R. | |
| dc.contributor.institution | Universidade Federal de São João del-Rei (UFSJ) | |
| dc.contributor.institution | Universidade Estadual Paulista (Unesp) | |
| dc.contributor.institution | Universidade Federal de Rondônia (UNIR) | |
| dc.contributor.institution | Universidade Estadual de Campinas (UNICAMP) | |
| dc.contributor.institution | Univ Barcelona | |
| dc.contributor.institution | CIBER BBN | |
| dc.contributor.institution | Universidade Federal de Minas Gerais (UFMG) | |
| dc.date.accessioned | 2014-05-20T15:30:22Z | |
| dc.date.available | 2014-05-20T15:30:22Z | |
| dc.date.issued | 2012-08-01 | |
| dc.description.abstract | Crotalus oreganus abyssus is a rattlesnake that is usually found in the Grand Canyon, United States of America. Knowledge regarding the composition of C. o. abyssus venom is scarce. New natriuretic peptides (NPs) have been isolated and characterized from the venoms of members of the Crotalinae family. The NP family comprises three members, ANP (atrial natriuretic peptide), BNP (b-type natriuretic peptide) and CNP (c-type natriuretic peptide), and has an important role in blood pressure regulation and electrolyte homeostasis. The aim of the present study was to characterize a novel natriuretic-like peptide (Coa_NP2), isolated from C. o. abyssus venom. The Coa_NP2 presents an average molecular mass of 3419.88 da (theoretical average molecular mass 3418.94 Da, monoisotopic molecular mass 3416.66 da and theoretical PI 7.78) and its amino acid sequence presents the loop region that is characteristic of natriuretic peptides. The peptide has 32 amino acids and its complete sequence is SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP. Coa_NP2 is a natriuretic peptide of the ANP/BNP-like family, since the carboxyterminal region of CNP has its own NP domain. We demonstrate, herein, that Coa_NP2 produces a dose-dependent decrease in mean arterial pressure in rats, followed by significant increases in concentrations of markers of nitric oxide formation measured in the plasma and vasorelaxation in a thoracic aortic ring bath. The structural and biological aspects confirm Coa_NP2 as a new natriuretic peptide, isolated from snake venom.(C) 2012 Elsevier B.V. All rights reserved. | en |
| dc.description.affiliation | Univ Fed Sao Joao Del Rei, BR-36420000 Ouro Branco, MG, Brazil | |
| dc.description.affiliation | Univ Estadual Paulista, BR-18618970 Botucatu, SP, Brazil | |
| dc.description.affiliation | Fed Univ Rondonia, Oswaldo Cruz Fdn, Porto Velho, Rondonia, Brazil | |
| dc.description.affiliation | Univ Estadual Campinas, Inst Biol, Dept Biochem, BR-13083970 Campinas, SP, Brazil | |
| dc.description.affiliation | Univ Barcelona, Inst Res Biomed, Barcelona, Spain | |
| dc.description.affiliation | CIBER BBN, Networking Ctr Bioengn Biomat & Nanomed, Barcelona 08028, Spain | |
| dc.description.affiliation | Univ Barcelona, Dept Organ Chem, Barcelona, Spain | |
| dc.description.affiliation | Universidade Federal de Minas Gerais (UFMG), Inst Biol Sci, Dept Biochem & Immunol, BR-31270901 Belo Horizonte, MG, Brazil | |
| dc.description.affiliationUnesp | Univ Estadual Paulista, BR-18618970 Botucatu, SP, Brazil | |
| dc.description.sponsorship | Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES) | |
| dc.description.sponsorship | Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq) | |
| dc.description.sponsorship | Fundação de Amparo à Pesquisa do Estado de Minas Gerais (FAPEMIG) | |
| dc.description.sponsorship | Fundação de Amparo à Pesquisa do Estado de São Paulo (FAPESP) | |
| dc.format.extent | 206-212 | |
| dc.identifier | http://dx.doi.org/10.1016/j.peptides.2012.05.005 | |
| dc.identifier.citation | Peptides. New York: Elsevier B.V., v. 36, n. 2, p. 206-212, 2012. | |
| dc.identifier.doi | 10.1016/j.peptides.2012.05.005 | |
| dc.identifier.issn | 0196-9781 | |
| dc.identifier.uri | http://hdl.handle.net/11449/39768 | |
| dc.identifier.wos | WOS:000307155100008 | |
| dc.language.iso | eng | |
| dc.publisher | Elsevier B.V. | |
| dc.relation.ispartof | Peptides | |
| dc.relation.ispartofjcr | 2.851 | |
| dc.relation.ispartofsjr | 1,001 | |
| dc.rights.accessRights | Acesso restrito | |
| dc.source | Web of Science | |
| dc.subject | Crotalus oreganus abyssus | en |
| dc.subject | Hypotensive agents | en |
| dc.subject | Snake venoms | en |
| dc.subject | Natriuretc peptides | en |
| dc.subject | Nitric oxide | en |
| dc.title | Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom | en |
| dc.type | Artigo | |
| dcterms.license | http://www.elsevier.com/about/open-access/open-access-policies/article-posting-policy | |
| dcterms.rightsHolder | Elsevier B.V. | |
| dspace.entity.type | Publication | |
| unesp.author.lattes | 6296664642422599[2] | |
| unesp.author.orcid | 0000-0002-0348-6144[2] |

